KEGG   Rhodococcus opacus B4: ROP_65580Help
Entry
ROP_65580         CDS       T00882                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00473  D-Alanine metabolism
rop00550  Peptidoglycan biosynthesis
rop01100  Metabolic pathways
rop01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ROP_65580 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ROP_65580 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ROP_65580 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rop01011]
    ROP_65580 (ddl)
Enzymes [BR:rop01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ROP_65580 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:rop01011]
 Precursor biosynthesis
  Amino acid ligase
   ROP_65580 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 RimK CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: BAH54805
NITE: ROP_65580
UniProt: C1B2N8
LinkDB All DBs
Position
7175138..7176244
Genome map
AA seq 368 aa AA seqDB search
MSKPRTRVAVIFGGRSNEHSVSCVSAGSVLRNLDPERYEVVPIGITTEGSWVLGSTDPES
LSIRGRSLPSVDADGSALALTADPTRSGDLVALDDGEAGKILASVDVVFPVLHGAYGEDG
TIQGLLELAGVPYVGPGVLASAAGMDKEFTKKLLAAEGLPIGFQVVLRPGTATLTDEQRS
RLHLPVFVKPARGGSSIGITRVAEWAALDDAIAHARRHDPKVIVESGIAGREVECGVLEF
PDGDVRASVIAEIRMPEGADDDEAFYDFDSKYLDDVCEFDVPAKLEDSVSDEIRALAVRA
FSALDCQGLARVDFFVTEDGPVINEINTMPGFTSISMYPRMWDAVGVDYGTLVSTLVDTA
LARGTGLR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaccgcgtacccgggtagccgtcatcttcggtggccgcagcaacgagcattcc
gtgtcctgtgtgtcggccggaagcgtcctgaggaatctcgacccggaacggtacgaggtg
gtgccgatcggcatcaccaccgagggttcgtgggttctcggctccaccgaccccgagtcg
ctgtccatccgcggccggtcgttgcccagtgtcgacgccgacgggtccgcgctggcgctc
accgcagatccgacgcggtccggcgacctcgtcgcactcgacgacggcgaagcgggcaag
atcctggcgtccgtcgacgtcgtcttccccgtcctgcacggcgcctacggcgaggacggc
accatccagggcctgctcgagctcgccggtgtcccgtacgtcggtcccggcgtgctcgct
agcgcggcaggcatggacaaggaattcacgaagaaactgctcgccgcggaaggcctgccg
atcgggttccaggtcgtcctgcgtcccggcaccgccacgctgaccgacgagcagaggtcg
cgcctccacctcccggtgttcgtgaaaccggcccgcggcggctcgtccatcggcatcacc
cgggtggccgagtgggccgcactcgacgacgccatcgcccacgcccgccggcacgatccc
aaggtgatcgtcgaatcggggatcgcaggccgcgaggtcgagtgcggagtcctcgagttc
ccggacggcgacgtgcgggccagcgtcatcgccgagatccggatgccggaaggggccgac
gacgacgaggcgttctacgacttcgacagcaaatacctcgacgacgtgtgcgagttcgac
gtgcccgcgaaactcgaggactcggtcagcgacgagatccgcgcactcgcggtgcgcgca
ttctccgcgctcgactgccagggactcgcgcgcgtcgacttcttcgtcaccgaggacggc
ccggtgatcaacgagatcaacacgatgccgggattcacgtccatttcgatgtacccgcgc
atgtgggacgccgtgggcgtcgactacggcaccctcgtctcgaccctggtcgacaccgcc
ctcgcgcgcggcaccggcctgcgatag

DBGET integrated database retrieval system