KEGG   Raoultella ornithinolytica B6: RORB6_02380Help
Entry
RORB6_02380       CDS       T02625                                 

Definition
(GenBank) alcohol dehydrogenase GroES domain-containing protein
Organism
ror  Raoultella ornithinolytica B6
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C TrkA_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AGJ85174
LinkDB All DBs
Position
complement(551550..552593)
Genome map
AA seq 347 aa AA seqDB search
MIPKLMKAAVLTAPKTFEIRQVAVPAYGDDEVLIRVTRCSICGTDIHIYNGHYSQDKLPL
IPGHEFSGEIVAVGRQVSTLTPGQRVVADINIGCGHCYYCRRNELLNCPEIRQLGIHTHG
AFAQYVAIPARLVIPLGDEIADSVACLTEPFSCVVRASKKIGLSVAESVVVIGAGPVGNM
HIQMARLLGAAPIIAVELNPQRAELARQCGADSVITDPERALEQIKALTEGRGADVVIES
VGHPELYQQALTFMRPGGRLLAFGLTDAETEIAIKPLEIILKEQRIQGSVAGMGEDMHQA
LHLLSHQRFITAPFRESVHPLEDIQQVFSTLLAHPQHLKIQLRIAEE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgatccccaaattaatgaaggccgcggtgctgacggcaccgaaaacgttcgaaatacgc
caggttgcggtccccgcctacggcgacgacgaggtactgattcgcgtcacccgctgttca
atctgcggaaccgatattcatatctataatggccattactcccaggataagctgccgtta
attcccggccacgagttcagcggggaaattgttgccgttggtcgccaggtctcgactctg
acgccgggccagcgggtggtcgccgatatcaatatcggctgcggccactgttattattgt
cggcgcaacgaactgctgaactgcccggagatccgccagctcggcattcacacccacggc
gcgtttgcgcagtatgtggcgattccagcccgtctggtgatcccgctcggcgatgagatt
gcggatagcgttgcctgcctgaccgaacccttctcttgcgtggtgcgcgccagtaaaaaa
atcggcctcagcgtggcagagtccgtggtggtgattggcgcgggcccggtgggcaacatg
catattcagatggcgcgtttgctgggcgccgcgccgattattgccgtggagctgaatccg
cagcgggccgagctcgccagacagtgcggtgcggatagcgtcatcaccgaccccgaacgc
gcgctggagcagatcaaggcgctcacggagggacgcggcgccgacgtggtcatcgaaagc
gtcggccatccggaattgtatcaacaggcgctgacgtttatgcgcccaggcggacggctg
ctggccttcggtttaaccgatgcggaaaccgagatagccattaaaccgctggagataatt
ttaaaggagcaaaggattcagggcagcgtggccgggatgggggaagatatgcaccaggcg
ctgcatctgctgagccatcaacgttttattaccgccccgttccgcgagtccgttcacccg
ctggaggatattcagcaggttttctccaccctgctcgctcatccgcagcacctgaaaatt
cagctacgtattgccgaggagtaa

DBGET integrated database retrieval system