KEGG   Raoultella ornithinolytica B6: RORB6_02550Help
Entry
RORB6_02550       CDS       T02625                                 

Definition
(GenBank) XylA
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror00040  Pentose and glucuronate interconversions
ror00051  Fructose and mannose metabolism
ror01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ror00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RORB6_02550
   00051 Fructose and mannose metabolism
    RORB6_02550
Enzymes [BR:ror01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     RORB6_02550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AGJ85206
LinkDB All DBs
Position
606616..607596
Genome map
AA seq 326 aa AA seqDB search
MSELKFATRLNSFASGANLYWPDLQGKPSVLQMIARAGTVKGLTHLDLNYPQHITTDIQT
LRQAIEDAGLAVNGMQMRWDAPQFKIGAFTNPNPQIRREAIELTKRGIDAGREFGSRLMT
LWMGQDGYDYCFQADYKKIWDDAVSAVREIAEYAPDVDISIEYKPNEPRAYSIFPNATTC
LLAVEEAGCPNLGITLDFAHVLFANEIPAYAAAMVARRSRLLGLDLNDGWGKRDDGLMVG
SVNPRATLEFLWQMQRDGYQGAYYFDTFPDASGLDPVREAEINIATVTRLLKLCARLNDN
DELTSAISRQDAVASQRIVNDIMLAR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaactgaaatttgccacgcgtctaaactcttttgcctcaggagctaacctctac
tggccggatcttcagggaaaaccctctgtactgcagatgattgcccgtgccggtacggtt
aaggggttaacccaccttgatctgaactacccgcaacacatcacgacggatattcaaacg
ctgcgccaggccattgaagatgcagggctggcggtcaacggaatgcaaatgcgctgggat
gcaccgcaatttaaaatcggggcatttactaaccctaatccgcagatccgccgcgaggcc
attgaactgacaaaacgcgggattgatgccggacgggaatttggttcccgcctgatgacg
ctctggatggggcaggatggctatgactattgcttccaggccgattacaaaaaaatctgg
gacgatgcggtgagtgcggtccgcgaaattgccgaatatgcgccggacgttgatatcagt
attgaatacaaaccgaatgaaccgcgggcttacagtattttccccaatgccacgacctgt
ttgctggcggtagaagaggcgggttgcccgaacctgggtatcacgctcgattttgctcat
gtgctgtttgctaatgagatcccggcctacgcagccgcgatggtcgctcgccgttcacgc
ctgctggggcttgatctcaatgatggctgggggaaacgtgacgatggcttgatggtgggg
tcggtaaatccgcgtgccacgctggaattcctctggcagatgcagagagatggttatcag
ggcgcctattactttgacaccttcccggatgccagcggtcttgatccggttcgtgaagct
gaaatcaacattgctaccgttactcgattgctcaaactgtgtgcccggcttaatgataat
gatgaactgacctcagccatcagccgtcaggatgcggtggcctctcaacgaatcgtcaat
gacatcatgctagccagatag

DBGET integrated database retrieval system