KEGG   Raoultella ornithinolytica B6: RORB6_13065Help
Entry
RORB6_13065       CDS       T02625                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ror00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RORB6_13065
Enzymes [BR:ror01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     RORB6_13065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434
Motif
Other DBs
NCBI-ProteinID: AGJ87294
LinkDB All DBs
Position
complement(2863583..2865640)
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLSPKVNALLHGADYNPEQWENYPGIIDQDIAMMQQAKCNVMSVGIFSWAKLEPQ
EGVFEFGWLDSILDKLYAAGIHVFLATPSGARPAWMSQAYPQVLRVGRDRVPALHGGRHN
HCMTSPVYREKIFKINSLLAERYAQHPAVLGWHISNEYGGDCHCERCQARFRDWLKARYQ
TLDNLNHAWWSTFWSHTYSDWSQIESPAPQGEVSIHGLNLDWRRFNTAQVTDFCRHEIAP
LKAANADLPVTTNFMEYFYDYDYWQLAQALDFISWDSYPMWHRDKDETTLACYTAMYHDM
MRSLKGGKPFVLMESTPSATNWQPTSKLKKPGMHILSSMQAVAHGADSVQYFQWRKSRGS
VEKFHGAVIDHVGHLDTRVGREVSRLGDMLSRLPGVVGCRTDAKVAIIFDQQNRWALDDA
QGPRNLGMEYENTVNEHYRPFWEQGIAVDIIDADGDLSAYQLVIAPMLYMVRDGFAARAE
AFVADGGHLVTTYWTGIVNESDLCHLGGFPGPLRNLLGIWAEEIDCLNDGERNLVQGLAG
NEGGLQGPYQVRHLCELIHAESARPLATYRDDFYAGRPAVTVNHFGKGKAWHVASRNDLA
FQRDFFAVISRELALPRAIESELPPGVVATARTDGETTYVFLQNYSAQQHSVSLPQGYQD
SLSGAAISAPLTLTAWDCRILSRKA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcgcctttgagtccgaaggtcaatgcgctattgcatggcgctgactat
aacccggaacagtgggaaaattatcccggtattatcgatcaagatattgccatgatgcag
caggctaaatgcaatgtcatgtcggtggggattttcagctgggccaaacttgaacctcag
gaaggcgtatttgaatttggctggctggacagcattctggataagctgtacgccgccggt
attcacgtatttctggctacgccaagcggcgcacgcccggcctggatgtcgcaggcctat
ccgcaggtgctgcgagtggggcgcgaccgggtaccggcgctgcacggcggacggcataac
cactgtatgacgtcaccggtttatcgggagaagatttttaaaatcaacagcctgctcgcg
gaacgctacgcacagcatccggcggttctcggctggcatatttccaatgaatatggcgga
gattgccattgtgaacgctgtcaggcgcggttccgcgactggctgaaagcgcgttatcaa
acgctggataatctcaatcacgcctggtggagcactttctggagccatacctacagcgac
tggtcgcagattgagtcgccggcaccgcagggggaagtgtccattcacgggctgaacctt
gactggcgtcgctttaacacggcgcaggtcacggacttctgccgccatgagattgccccg
ctgaaggcggcgaatgccgacctgccggtgaccaccaacttcatggagtacttctacgat
tacgactactggcagctggcgcaggcgctggatttcatctcctgggatagctatccgatg
tggcatcgcgacaaagatgaaaccacgctggcctgctataccgcgatgtaccatgacatg
atgcgcagtctgaagggcggcaagccgttcgtgctgatggaatcaacgccgagcgccacc
aactggcagccgaccagtaagttgaaaaaaccggggatgcatattctctcctccatgcag
gctgtcgcccacggggcagactcagttcagtatttccagtggcgtaagagccgtggctcg
gtggagaaattccacggcgcggtcattgaccacgttggtcatctggatacccgcgtcggc
cgcgaagtcagccggctgggtgatatgctcagtcgtctgcctggcgtggtgggctgtcgc
accgatgcgaaagtggcgattatctttgaccagcaaaaccgctgggcgctggatgatgcg
cagggcccgcgtaatctcgggatggagtatgaaaataccgttaatgaacactaccggcca
ttctgggagcagggtattgcggtcgatatcatcgatgccgatggcgacctgagcgcctac
cagctggttatcgccccgatgctgtatatggttcgcgatgggtttgccgcgcgcgccgaa
gcgtttgtcgccgacggaggccatctggtgaccacttactggacggggatcgttaatgaa
tccgatctttgccaccttggtggtttcccgggaccgctgcgcaacctgctggggatttgg
gcggaggagattgattgcctgaatgacggcgagcgcaacctggttcaggggctggcaggc
aacgaaggcgggttacaggggccgtatcaggtgcgccatctgtgcgagctgattcatgcc
gaaagcgcccggccgctggcaacctatcgtgatgatttctacgccggccgcccggcggtg
accgttaatcatttcggcaaggggaaggcctggcatgtcgcctcacgcaacgacctggct
ttccagcgcgatttcttcgcggttatcagccgggagctggccttaccgcgggcgatcgag
agtgagcttccgccgggcgtggtcgccacggcccgcaccgatggcgaaacgacctatgtt
ttcttgcagaactacagcgctcagcagcacagcgtaagcctgccgcagggctatcaggac
agtctctccggtgcggccattagcgcgccgttgaccttaaccgcatgggactgccgtatt
ctcagtcgtaaagcgtaa

DBGET integrated database retrieval system