KEGG   Raoultella ornithinolytica B6: RORB6_20130Help
Entry
RORB6_20130       CDS       T02625                                 

Definition
(GenBank) 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD
  KO
K13014  undecaprenyl phosphate-alpha-L-ara4FN deformylase [EC:3.5.1.-]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror00520  Amino sugar and nucleotide sugar metabolism
ror01100  Metabolic pathways
ror01503  Cationic antimicrobial peptide (CAMP) resistance
Module
ror_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:ror00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RORB6_20130
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    RORB6_20130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ror01005]
    RORB6_20130
Enzymes [BR:ror01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     RORB6_20130
Lipopolysaccharide biosynthesis proteins [BR:ror01005]
 Unusual sugar
  RORB6_20130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: AGJ88706
LinkDB All DBs
Position
4455556..4456458
Genome map
AA seq 300 aa AA seqDB search
MKQVGLRIDVDTFRGTRDGVPRLLSLLGQHGVQASFFFSVGPDNMGRHLWRLIKPKFLWK
MLRSNAASLYGWDILLAGTAWPGRRIGAGNEEVIRATAQAHEVGLHAWDHYSWQAWSGVW
PQERLALEVERGLLELERIIGRSVTCSAVAGWRADQRVIKAKESFNFLYNSDCRGSRPFL
PLLGDKVTGTVQIPVTLPTWDEVVGSRVDAGGFNRYLLDCIHRDSGTPVYTIHAEVEGIA
FAQQFDELLTMAAQEEIQFCPLSQLLPADFSELPLGKVVRGELAGREGWLGREQLLSQDV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggtcggcttacgcatagatgtcgatacctttcgcggtacccgggacggggta
ccgcgtctgctgagcctgttgggccagcacggggttcaggcaagcttcttcttcagcgtt
gggccggacaatatggggcgccatttatggcgcctgataaaaccgaagtttctgtggaag
atgctgcgctcaaacgccgcttcgctgtacggctgggatattttgctggccggcaccgca
tggcctgggcgacggattggcgcgggtaatgaagaggttatccgtgcgacggcgcaggcg
catgaagtgggtctgcatgcctgggatcattacagctggcaggcatggagcggcgtctgg
ccacaggaacggctggcgctggaggtcgaacgcggcctgctcgagctggagcggatcatc
ggccggtcggtcacctgttccgcggtggcgggctggcgcgcggatcagcgggtgattaaa
gccaaagagtccttcaatttcctctacaacagcgactgccggggctcgcgccccttcctg
ccgttgctgggcgacaaggtgacaggtacggtgcagatccccgttacgctgcctacctgg
gatgaagtggtcggcagtcgcgtcgatgccgggggcttcaatcgctatctgctggattgt
attcaccgggatagcggtacgccggtctacaccattcatgctgaagtggaaggcattgcc
ttcgcgcagcagtttgatgaactgctgacgatggccgcacaggaagaaatccagttttgc
ccgctgagccaactgctgcccgcagattttagcgagctgccgctgggtaaagtggttcgc
ggtgaattggccggccgggaaggctggcttgggcgtgaacaattattgagtcaggacgta
tga

DBGET integrated database retrieval system