KEGG   Raoultella ornithinolytica B6: RORB6_20310Help
Entry
RORB6_20310       CDS       T02625                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror00250  Alanine, aspartate and glutamate metabolism
ror00410  beta-Alanine metabolism
ror00640  Propanoate metabolism
ror00650  Butanoate metabolism
ror01100  Metabolic pathways
ror01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ror00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RORB6_20310
   00650 Butanoate metabolism
    RORB6_20310
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RORB6_20310
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RORB6_20310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ror01007]
    RORB6_20310
Enzymes [BR:ror01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RORB6_20310
Amino acid related enzymes [BR:ror01007]
 Aminotransferase (transaminase)
  Class III
   RORB6_20310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGJ88742
LinkDB All DBs
Position
4488305..4489570
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
IVAAVAQQLEAFTHTAYQIVPYESYVSLAERINALAPVDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYPNAAHGITTD
EAMKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPAEFMQALRTLCDTHGILLIADEV
QTGFARTGKLFAMQHYDVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEEEQLCQRAEQLGSHLKEVLNQAREYCPAIVDVRGQGSMVAVEFND
PQTGAPSPEFTRHIQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFTKALDILARVLK
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagttcagaactgaatcaacgtcgccagcaggcgacgccgcgcggcgtaggcgta
atgtgcaattactttgttgagaaggcggagaatgccacgctgtgggatgtggaaggtaac
gaggtgattgattttgctgcgggaatcgccgtgctcaataccggccatcgccacccgaaa
attgttgccgccgtcgcgcagcagctggaggcctttacccatacggcgtatcagattgtc
ccttacgaaagctatgtttcgctggcggagcgcattaacgcgctggcgccggtcgatggc
ccggccaaaaccgctttcttcaccaccggtgcggaagccgtggaaaatgcggtgaagatt
gcccgcgcttataccggccgtccggggctgattacttttggcggcggctttcacgggcgt
acctttatgaccatggcgctgaccggtaaagtcgcgccttacaaaatcggttttggaccg
ttccctggttcggtttatcacggggtatacccgaatgctgcccacggcatcaccaccgat
gaggcgatgaaaagccttgagcgtatctttaaagccgatattgccccggaccaggtggcg
gcaattatcctcgagccgattcagggcgaaggcggttttaacgtcgcgccagcggagttt
atgcaggcgctgcgtacgctgtgcgatacccacggcatcctgctgattgccgatgaagtg
cagaccggttttgcccgcaccggcaagctgtttgctatgcagcattacgatgtgaagccg
gacctgatgacgatggcgaaaagccttgccggcggtttcccgctgtcaggcgtagtgggg
cgcgccgaggtgatggatgcgccggcgccgggcggactgggcggcacctatgccggtaac
ccgctggcggtcgccgcggctcatgcggtccttgacgtcattgaagaagagcagctgtgt
caacgtgcggaacagcttggcagccacctgaaagaggtgctgaatcaggcgcgcgagtat
tgtccggcgattgttgatgttcgcggccagggctcaatggttgccgtggagtttaacgat
ccgcagaccggcgcgccgtcaccggagttcacccgccacattcagcaaaaggcgcaggaa
aatggtctgctgctgctgagctgcggcgtctatggcaacgttatccgtttcctgtatccg
ttaactatccccgatgcgcagtttacaaaagcgctggatattctggcgcgcgtcctgaag
ggatga

DBGET integrated database retrieval system