KEGG   Raoultella ornithinolytica B6: RORB6_20440Help
Entry
RORB6_20440       CDS       T02625                                 

Definition
(GenBank) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror00260  Glycine, serine and threonine metabolism
ror00261  Monobactam biosynthesis
ror00270  Cysteine and methionine metabolism
ror00300  Lysine biosynthesis
ror01100  Metabolic pathways
ror01110  Biosynthesis of secondary metabolites
ror01120  Microbial metabolism in diverse environments
ror01130  Biosynthesis of antibiotics
ror01210  2-Oxocarboxylic acid metabolism
ror01230  Biosynthesis of amino acids
Module
ror_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
ror_M00017  Methionine biosynthesis, apartate => homoserine => methionine
ror_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ror00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RORB6_20440
   00270 Cysteine and methionine metabolism
    RORB6_20440
   00300 Lysine biosynthesis
    RORB6_20440
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    RORB6_20440
Enzymes [BR:ror01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     RORB6_20440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AGJ88768
LinkDB All DBs
Position
4517463..4518569
Genome map
AA seq 368 aa AA seqDB search
MKNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQPAPSFGGSTGGTLQDAFD
LDALKALDIIVTCQGGDYTNDVYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVI
TAGLNNGVKTFVGGNCTVSLMLMSLGGLFAQDLVEWVSVATYQAASGGGARHMRELLTQM
GQLHSHVATELANPASAILDIERKVTALTRSGDLAVDNFGVPLAGSLIPWIDKQLDNGQS
REEWKGQAETNKILATSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHN
PWAKVVPNDRDITMRELTPAAVTGTLTTPVGRLRKLNMGPEYLSAFTVGDQLLWGAAEPL
RRMLRQLA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttggttttatcggctggcgcggaatggtcggctctgtactcatgcaacgc
atggttgaagagcgcgacttcgacgccattcgccctgtttttttctccacctctcagctg
gggcagcctgctccatcctttggtggtagcaccggcggtacgctgcaggacgcgtttgat
ctggacgcgctgaaggcgttggacattattgtgacctgccagggcggggattataccaac
gacgtgtatccgaagctgcgtgagagcggctggcagggttactggattgacgccgcctct
tcgctgcgcatgaaagacgacgccatcattattcttgatccggtaaaccaggatgtgatt
accgccggtctgaataatggcgtgaaaacgtttgttggcggcaactgtaccgtcagcctg
atgctgatgtccctcggcggcctgtttgcccaggatctcgtggagtgggtgagcgtggcc
acttaccaggcggcatccggtggcggggcgcgtcacatgcgcgaactgctgacccagatg
ggccagctgcatagccacgtggcgacagagctggcgaatccggcgtccgccattctggat
atcgaacgcaaagtgacggcgctgacccgcagcggcgacctggcggttgataactttggc
gtgccgctggcaggcagtttgatcccatggatcgacaaacagctggataacggccagagc
cgtgaagagtggaaaggacaggctgagaccaacaaaattctcgccacctcgtcagtgatt
ccggttgatggcctgtgtgtacgcgttggcgcgctgcgttgccacagccaggcgtttacc
atcaagctgaaaaaagatgtctctatcccgaccgttgaagaactgttggccgcacacaac
ccgtgggccaaagtcgtaccgaacgatcgtgatattacaatgcgtgagctgaccccggct
gccgtcaccggcaccctgaccacgccggtgggtcgtttgcgtaagctgaatatggggccg
gaatatctgtcggctttcaccgtcggtgaccagctcctgtggggcgctgccgagccgctg
cgacgcatgctgcgccagctggcttga

DBGET integrated database retrieval system