KEGG   Roseomonas sp. FDAARGOS_362: CTJ15_09475Help
Entry
CTJ15_09475       CDS       T05160                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ros  Roseomonas sp. FDAARGOS_362
Pathway
ros00970  Aminoacyl-tRNA biosynthesis
ros01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ros00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CTJ15_09475
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ros03029]
    CTJ15_09475
Enzymes [BR:ros01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CTJ15_09475
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CTJ15_09475
Mitochondrial biogenesis [BR:ros03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CTJ15_09475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ATR20513
UniProt: A0A2D2H3B3
LinkDB All DBs
Position
complement(1006398..1007852)
Genome map
AA seq 484 aa AA seqDB search
MSYTIEGETGPWELVIGLEVHAQVSSEAKLFSGAATEFGAAPNSQVSFVDAGMPGMLPVI
NRECVAQAVRTGLGLKAKINPWSRFDRKNYFYADLPTGYQISQFAFPIVGEGKLTIELSD
GTAKEIGITRLHLEQDAGKSLHDQDPSRTFVDLNRAGVALMEIVSEPELRSPEEAGAYVT
KLRQILRYLGTCDGNMEEGSLRADVNVSVRKTGEGFRTRCEVKNVNSIRFVMQAVEAEAR
RQIEVWESGGTVEQETRLFDTGRGVTRSMRSKEDAHDYRYFPDPDLPPLVLEPAWIEELK
SGLSELPDDRRARYVGEYGLTAYDAHVLTLEKETAAYYEEVARGRDAKQAANWVMGDLFA
ALNRTRTDITTSPVSAKDLGALLDLMADNTLSGKLAKEVFEAMVETGRSPGEIVEERGLR
QVTDTGAIEAVVDEVLAKNADKVAEYRSGKDKLFGFFVGQTMRAMQGKGNPALVNEVIKA
KLAG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagctatacgatcgagggcgagaccggcccctgggaactggtgatcgggctggaggtc
catgcccaggtcagttccgaagccaagctcttctccggcgcggcgaccgaattcggcgcc
gcgccgaacagccaggtttccttcgtggatgccggcatgccgggcatgctgccggtcatc
aaccgggaatgcgtggcccaggcggtgcgcaccgggctggggctgaaggcgaagatcaat
ccctggtcgcgcttcgaccggaagaactatttctacgccgacctgccgacgggctatcag
atcagccagttcgctttccccatcgtgggggagggcaagctgaccatcgagctgtccgac
ggcacggcgaaggagatcggcatcacccgtctgcatctggagcaggatgccggcaagtcg
ctgcacgaccaggacccgtcgcggaccttcgtggacctgaaccgggccggcgtggcgctg
atggagatcgtctccgagccggagctccgctcgccggaagaggccggggcctatgtcacc
aagctgcggcagatcctgcgctatctcggcacctgcgacggcaacatggaggaaggcagc
ctccgcgccgacgtgaacgtctccgtgcgcaagacgggggaggggttccgcacgcgctgc
gaggtgaagaacgtcaactccatccgcttcgtcatgcaggccgtcgaggccgaggcgcgg
cgccagatcgaggtctgggaatcgggtggcacggtggagcaggagacgcggctcttcgac
accggccggggcgtgacgcgctccatgcgttccaaggaggatgcgcatgactaccgctac
ttccccgacccggacctgccgccgctggtgctggagccggcctggatcgaggagctgaaa
tccgggctttccgagctgccggacgaccgccgcgcccgctatgtcggcgaatacggcctc
accgcctatgacgcccatgtgctgacgctggagaaggagacggccgcctattacgaggag
gtcgcccgcgggcgcgatgccaagcaggcggccaactgggtgatgggcgatctcttcgcg
gcgctgaaccgcaccaggacggacatcaccacttccccggtctcggcgaaggatctgggc
gcgctgctggacctgatggcggacaacaccctgtccggcaagctggccaaggaggtcttc
gaggccatggtcgagacgggccgctcgcccggcgagatcgtggaggagcgggggctgagg
caggtgaccgataccggcgccatcgaggcggtggtggatgaggttctggcgaagaacgcc
gacaaggtggccgagtaccgttccggcaaggacaagctcttcggcttcttcgtgggccag
acgatgcgggccatgcagggcaagggcaacccggccctggtgaacgaggtcatcaaggcc
aagctcgccggctga

DBGET integrated database retrieval system