KEGG   Roseomonas sp. FDAARGOS_362: CTJ15_12685Help
Entry
CTJ15_12685       CDS       T05160                                 

Gene name
ntrB
Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
ros  Roseomonas sp. FDAARGOS_362
Pathway
ros00910  Nitrogen metabolism
ros02010  ABC transporters
Module
ros_M00438  Nitrate/nitrite transport system
ros_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ros00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    CTJ15_12685 (ntrB)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CTJ15_12685 (ntrB)
Transporters [BR:ros02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    CTJ15_12685 (ntrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Romo1
Motif
Other DBs
NCBI-ProteinID: ATR21072
UniProt: A0A2D2H4Z2
LinkDB All DBs
Position
1671139..1672011
Genome map
AA seq 290 aa AA seqDB search
MNAVTPVKGVPAGGSTTAPPEFRQPSALALKVRHVAQNVLPPLLVLLVLGLVWQVLCSRP
DATLPAPSKVWTDSYDLIVDPFFDRGGLDKGLFWHLAASLSRVAMGFSIAVVVGIATGML
IGTSDFAMRGLDPLFQVLRTVPPLAWLPLSLAAFREAQPSAIFVIFITSVWPIIINTAVG
VRNVPQDYRNVAKVLRMSLPDWFLRIVIPSAAPYIFTGLRIGVGLSWLAIIAAEMLIGGV
GIGFFIWDAWNSSNLSDIIVALVYVGVVGFLLDRLVALIGRLVTRGTASA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgtcacccccgtcaagggcgtgcccgccggtggctccaccaccgcaccgccc
gagttccgccagccctccgccctggcgctgaaggtccgccatgtcgcgcagaacgtcctg
ccgccgctgctcgtgctgctggtgctgggcctggtctggcaggtgctctgctcccgcccg
gatgccacgctccccgcgcccagcaaggtctggacggacagctacgacctgatcgtcgat
cccttcttcgaccgtggcgggttggacaagggcctgttctggcacctcgccgcctcgctc
tcccgcgtcgccatgggcttctccatcgcggtggtggtaggcatcgccacggggatgctg
atcggcacctcggacttcgccatgcgcggcctcgacccgctcttccaggtgctgcgcacc
gtgccgccgctggcctggctgccgctctccctcgccgccttccgcgaggcgcagccctcg
gcgatcttcgtgatcttcatcacctcggtctggccgatcatcatcaacaccgccgtcggc
gtgcgcaacgtgccgcaggactaccgcaacgtcgccaaggtgctgcggatgagcctgccc
gactggttcctgcgcatcgtgatcccctccgccgcgccctacatcttcaccggcctgcgc
atcggcgtcggcctttcctggctcgccatcatcgcggcggagatgctgatcggcggcgtc
ggcatcggcttcttcatctgggatgcctggaactcctccaacctctccgacatcatcgtg
gcgctggtctatgtcggcgtggtcggcttcctgctcgaccgcctcgtcgccctgatcggc
cgcctcgtcacccgcggcaccgcctcggcctga

DBGET integrated database retrieval system