KEGG   Roseomonas sp. FDAARGOS_362: CTJ15_19110Help
Entry
CTJ15_19110       CDS       T05160                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
ros  Roseomonas sp. FDAARGOS_362
Pathway
ros00010  Glycolysis / Gluconeogenesis
ros00620  Pyruvate metabolism
ros01100  Metabolic pathways
ros01110  Biosynthesis of secondary metabolites
ros01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ros00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTJ15_19110
   00620 Pyruvate metabolism
    CTJ15_19110
Enzymes [BR:ros01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CTJ15_19110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ATR22210
UniProt: A0A2D2H854
LinkDB All DBs
Position
3199127..3200644
Genome map
AA seq 505 aa AA seqDB search
MTKLDALRVTDSPFKRRYGNFIAGQWVEPASGQTFANTSPVNGRVLCEVARSDATDIDRA
LDAAHAAKDAWGRTSAAERARLLNAIAQRMEDNLDLLARAETFDNGKPIRETTAADLPLA
IDHFRYFAGCIRAQEGALSEIDHDTVAYHFHEPLGVVGQIIPWNFPILMACWKLAPALAA
GNCVVLKPAEQTPASILVLADLIADILPPGVLNIVNGFGLEAGKPLALSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVGAEDDDFLDKAIEGFVMFALNQGEVC
TCPSRALIHESLYDRFMEKALKRVGDIRQGDPLDPSTMIGAQASSEQLEKILSYIDIGKQ
EGAEVLIGGERNVLSGDLAEGFYMKPTVFHGHNRMRVFQEEIFGPVVSVTTFKDDDEALS
IANDTLYGLGAGVWTRDANRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRENH
RMMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagctcgacgccctgcgcgtgacggattccccgttcaagcggcgctacggcaac
ttcattgccggccagtgggtggaacccgccagcggccagaccttcgccaacacctccccc
gtcaacggccgcgtcctctgcgaggtcgcgcgctccgacgccaccgacatcgaccgcgcg
ctggatgccgcccatgcggcaaaggatgcctggggccgcaccagcgccgccgagcgcgcc
cgtctgctgaacgccatcgcgcagcgcatggaggacaatctcgacctcctcgcccgcgcc
gagacattcgacaacggcaagccgatccgcgagaccaccgccgccgacctgccgctcgcc
atcgaccatttccgctacttcgccggctgcatccgcgcgcaggaaggtgcgttgagcgag
atcgaccacgacaccgtcgcctatcacttccacgagccgctgggcgtcgtcggccagatc
atcccgtggaacttcccgatcctgatggcctgctggaagctcgcccccgcgctcgccgcc
ggcaactgcgtggtgctgaagcccgccgagcagacgccggcctcgatcctcgtgctcgcc
gacctgatcgccgacatcctgccgcccggcgtgctgaacatcgtcaacggcttcgggctg
gaggccggcaagccgctggcgctcagcccgcgcatcgccaagatcgccttcaccggcgag
acgacgacaggccggctgatcatgcagtatgccagccagaacctgatccccgtcacgctg
gagctcggcggcaagtcgcccaacatcttcttcaaggatgtcggcgccgaggacgacgac
ttcctcgacaaggcgatcgaaggattcgtgatgttcgcgctgaaccagggcgaggtctgc
acctgcccgtcccgcgcgctgatccatgagagcctctacgaccgcttcatggagaaggcg
ctgaagcgcgtcggggacatcaggcagggcgatccgctcgacccctccaccatgatcggc
gcccaggcctccagcgagcagctggagaagatcctgagctacatcgacatcggaaagcag
gaaggcgccgaggtgctgattggcggcgagcgcaacgtcctgtccggcgacctcgcggaa
ggcttctacatgaagcccaccgtcttccatggccataaccgcatgcgcgtcttccaggag
gagatcttcggccccgtcgtttccgtcaccaccttcaaggacgacgacgaggcgctctcc
atcgccaacgacacgctctatggcctgggcgccggcgtctggacgcgggacgcgaaccgc
gcctaccgcttcggccgtgccatccaggccgggcgcgtctggaccaactgctaccacgcc
tacccggcccatgcggccttcggcgggtacaagcaatcgggtatcgggcgcgagaaccat
cgcatgatgctcgaccactaccagcagaccaagaacatgctggtcagctacagcccgaag
aagctcggcttcttctga

DBGET integrated database retrieval system