KEGG   Roseomonas sp. FDAARGOS_362: CTJ15_23035Help
Entry
CTJ15_23035       CDS       T05160                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ros  Roseomonas sp. FDAARGOS_362
Pathway
ros00473  D-Alanine metabolism
ros00550  Peptidoglycan biosynthesis
ros01100  Metabolic pathways
ros01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ros00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CTJ15_23035
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CTJ15_23035
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CTJ15_23035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ros01011]
    CTJ15_23035
Enzymes [BR:ros01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CTJ15_23035
Peptidoglycan biosynthesis and degradation proteins [BR:ros01011]
 Precursor biosynthesis
  Amino acid ligase
   CTJ15_23035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 B12-binding Peripla_BP_6 ATP-grasp_4 ATP-grasp ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ATR22895
UniProt: A0A2D2HA33
LinkDB All DBs
Position
complement(4060104..4061069)
Genome map
AA seq 321 aa AA seqDB search
MTRVAVLLGGISAEREVSLSSGTQCAAALEKAGHEVTRIEVGQDPAALIQALRDAKPDVV
FNALHGRFGEDGCVQGILDWLGIPYTHSGVRASAMAMNKATAKAAFTAAGLPVAPHRLIE
AAELEEADPLPTPYVIKPVEEGSSVGVHIIKGGDNRRAEIARTWRYGTIMAEPYIPGREL
TVAVMGDRALEVTEINAEAGEFYDYDSKYADGGSRHTLPAPVPAAIRARAMEVALQAHRA
LGCRGVSRSDFRYDDTGEGEGRLVLLEVNTQPGMTPTSLVPEQAAHLGIAFPELCDWIVS
QARHDGMPPGRVPPGGLRHAA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcgtcgccgtccttctggggggaatttcggcggagcgggaggtctctttgtcc
tccggcacgcaatgcgccgccgcgctggaaaaggcggggcacgaggtcacccgcatcgag
gtgggccaggaccccgccgcgctgatccaggcgctgcgggacgcgaagcccgatgtggtg
ttcaacgccctgcacgggcgcttcggcgaggatggctgcgtccagggcatcctggactgg
ctcggcatcccctacacgcattcgggggtacgcgcctcggcgatggcgatgaacaaggcc
accgccaaggccgccttcaccgccgccggcctgcccgtggcgccgcaccggctgatcgag
gcggcggagctggaggaggccgatcccctccccactccctatgtcatcaagccggtggag
gaaggctcctcggtcggcgtgcacatcatcaagggcggcgacaaccgccgcgccgagatc
gcccggacctggcgctacggcaccatcatggccgagccctatatccccggccgcgagctg
accgtggcggtgatgggcgaccgcgcgctggaagtcaccgagatcaacgccgaggccggc
gagttctacgactacgactccaagtacgccgatggcggctcccgccacacgctgcccgcc
ccggtgcccgccgcgatccgcgcccgggccatggaggtggcgctgcaggcgcaccgcgcg
ctcggctgccgcggcgtctcgcgctccgacttccgctacgatgacaccggagagggcgag
ggccgcctcgttctgctggaggtcaacacccagcccggcatgacgcccacctcgctggtg
ccggaacaggcggcgcatctcggcatcgccttccccgagctctgcgactggatcgtctcc
caggcccgccacgacgggatgcccccgggtagggttccccctggcgggctgcgccatgcc
gcgtga

DBGET integrated database retrieval system