KEGG   Rahnella sp. ERMR1 05: BV494_00240Help
Entry
BV494_00240       CDS       T05331                                 

Definition
(GenBank) hypothetical protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
rox  Rahnella sp. ERMR1:05
Pathway
rox00040  Pentose and glucuronate interconversions
rox00051  Fructose and mannose metabolism
rox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BV494_00240
   00051 Fructose and mannose metabolism
    BV494_00240
Enzymes [BR:rox01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     BV494_00240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AVF33450
UniProt: A0A2L1UKI5
LinkDB All DBs
Position
45401..46381
Genome map
AA seq 326 aa AA seqDB search
MSELKFATRLNSFASGAYLYWPELKGKPSVLQMIERAATVKGLTHLDLNYPQHMTDDVKT
MRQKIEEVGLAVNGMQMRWDAPEFKIGAFTNPDPKIRRQAIELTKRGIDAGREFGASIMT
LWMGQDGFDYCFQADYKKMWEDAVSAVREVAEYAPDIDVSIEYKPNEPRAYSIFPNATTC
LLAVEEAGCKNLGITLDFAHVLFANEVPAFAAAMVARRSRLLGLDLNDGWGKRDDGLMVG
SVNPRATLEFLLQMKRDGYKGAYYFDTFPDASGLDPVREAETNIATVIRLLKLCEKLENN
PALNEAISRQDAVASQQIVNDVMLAQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacttaaatttgccacacgtctgaactcgtttgcctcgggggcttatctttac
tggccggaactgaaaggcaaaccttcagtactgcaaatgatcgaacgtgcagctacggtt
aaaggattgacacatcttgacctgaattatccccagcacatgactgacgacgtcaaaacc
atgcgtcagaaaatcgaagaagtcgggctggcggtcaacgggatgcaaatgcgctgggat
gctccggaatttaaaatcggcgcatttaccaacccggaccccaaaattcgtcgtcaggcg
attgagttaaccaaacgcggcatcgacgccgggcgcgaattcggtgccagcatcatgacg
ctgtggatggggcaggacggtttcgattattgcttccaggctgactacaaaaaaatgtgg
gaagacgcggtcagcgcggtgcgcgaagtggcggaatatgcgccggacatcgacgtcagc
attgaatacaaacccaacgaaccgcgcgcttacagcatcttcccgaatgccaccacctgt
ctgctggcggtggaagaagccggttgcaagaatttaggtatcacgctggatttcgcgcat
gtgctgtttgccaatgaagtcccggcgtttgccgcggcgatggtcgcacgccgttcacgc
ctgctcgggctggatctcaacgacggctggggcaaacgtgacgacggcctgatggtcggc
tccgtgaatccacgcgccacgctggaattcctgctgcaaatgaagcgtgacggctataaa
ggtgcgtattacttcgatacgttcccggacgccagcggtctggatccggttcgcgaagcc
gaaaccaatatcgcgaccgtgatccgtttactgaaactgtgtgaaaagctcgaaaacaac
ccggcgctgaatgaagccatcagcaggcaggatgccgtcgcctctcagcaaatcgtcaat
gacgtgatgctggcgcaataa

DBGET integrated database retrieval system