KEGG   Rahnella sp. ERMR1 05: BV494_01335Help
Entry
BV494_01335       CDS       T05331                                 

Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rox  Rahnella sp. ERMR1:05
Pathway
rox00071  Fatty acid degradation
rox00280  Valine, leucine and isoleucine degradation
rox00281  Geraniol degradation
rox00310  Lysine degradation
rox00362  Benzoate degradation
rox00380  Tryptophan metabolism
rox00410  beta-Alanine metabolism
rox00640  Propanoate metabolism
rox00650  Butanoate metabolism
rox00903  Limonene and pinene degradation
rox00930  Caprolactam degradation
rox01100  Metabolic pathways
rox01110  Biosynthesis of secondary metabolites
rox01120  Microbial metabolism in diverse environments
rox01130  Biosynthesis of antibiotics
rox01200  Carbon metabolism
rox01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BV494_01335
   00650 Butanoate metabolism
    BV494_01335
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BV494_01335
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BV494_01335
   00310 Lysine degradation
    BV494_01335
   00380 Tryptophan metabolism
    BV494_01335
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BV494_01335
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BV494_01335
   00281 Geraniol degradation
    BV494_01335
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BV494_01335
   00930 Caprolactam degradation
    BV494_01335
Enzymes [BR:rox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BV494_01335
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BV494_01335
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BV494_01335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AVF33647
UniProt: A0A2L1UL33
LinkDB All DBs
Position
275638..277806
Genome map
AA seq 722 aa AA seqDB search
MRDNMENPNIPEITPAEPVSAFSLMFTAEHVGIITVDVPGEKVNTLKAEFAQQICAILQK
AQQYPNLKGLVLVSGKTDSFIAGADITMISGCKTAVEASQLAQKGQTVMSQIASFSVPVV
AAIHGACLGGGLELALACHARVCSLDDKTQLGLPEVQLGLLPGSGGTQRLPRLIGAPKAL
DMMLTGRSIRAKQALRMGLVDDAVPYSILLKTALERVAKGRRSRPPLPWQARLAGGPLGK
SLLFYFVRKQTRAKTHGNYPATEKIIDVVKTGLDQGSGNGYQAEARAFGELVMTPQSAAL
RGLFFASTALKKEKGADAEPLPVSRVGILGGGLMGGGIANVTATRAGLPVRIKDINHEGI
RHALKYSWDLLEKKVRSRRLTRNEQQRQMMLISGTTDYSGFSQIDIVVEAVFEDLKLKQS
MVAEIEKNAAPHTIFASNTSSLPIHQIAEKATRPERVIGLHYFSPVDKMPLVEVIPHAGT
SAQTISTTVSLAKKQGKTAIVVGDSAGFYVNRILAPYINEAARCLLAGEPVDHIDNALVN
FGFPVGPVQLLDEVGIDVGTKIGPILVEAFGERFAAPSGFDAVLQDDRKGRKNGKGFYLY
GQKGRGTKKKQVDPSVYRLLNVTPKAQQSGEEIAQRCVMLMLNEAVRCLDENVIRSARDG
DLGAVFGIGFPPFRGGPFRYIDTLGAASVVKTLEQLAQRYGEHFTPCEGLRRRAEQGERF
CP
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgagagacaacatggaaaacccaaacattccggaaatcacgccagcagagccggtttcc
gctttctcgctgatgtttacggcagaacatgtcggcatcatcaccgttgatgttcccggc
gaaaaagtgaataccctgaaggctgaatttgctcagcaaatctgcgctattttgcaaaaa
gcgcagcagtatccgaatctgaaaggtctggtgctcgtttccggcaaaactgactcgttt
attgccggtgccgacatcacgatgatttccggctgcaaaacagcggttgaagccagccag
ttagcgcaaaaaggccagacggtcatgtcgcagatagcgtcgttttccgtgccggtcgtg
gcggctattcacggtgcctgtcttggcggcgggctcgaactggcgctggcgtgccatgcg
cgggtctgctcgctggatgataaaacgcagctcggcctgccggaagttcagttggggctt
ttacccggttcgggcggcacgcagcgtttaccgcgattaatcggtgcgccgaaagcactg
gatatgatgcttaccgggcgcagtattcgtgcgaaacaggcgctgagaatggggctggtg
gacgacgccgtgccttattctattttgctgaaaaccgcgctggaacgtgtcgccaaaggc
cgtagatcccggccacctttaccgtggcaggcgcggctggcgggcggtccgctggggaaa
agcctgttgttctattttgtacgcaaacagacccgcgcaaaaacgcacggtaattatccg
gccacggaaaaaattattgatgtggtgaaaaccggcctcgatcagggcagcggaaacggc
tatcaggccgaagccagggcttttggcgaactggtgatgacgccgcaatccgccgcactt
cgcggtttattctttgcctcgacggcgctgaaaaaagaaaaaggcgctgacgctgagccg
ctgccggttagtcgcgtcgggatcctcggtggcgggctgatgggcggcggcattgcgaat
gtcaccgcgacccgcgccgggctgccggtgcgtattaaagacattaatcacgaaggcata
cgccatgcgctgaaatacagctgggatctgctggagaaaaaagtccgcagccgcaggctt
acccgtaacgagcagcagcggcagatgatgctgatttccggcaccacggattacagcggt
ttctcgcagattgatatcgtggtggaagcggtatttgaagacctgaaactcaagcaatcc
atggtggcggagatcgagaaaaatgccgcaccgcacactatattcgcttcaaacacctct
tctttaccgattcatcagattgcggagaaggctacaaggcctgagcgggtgatcggcctg
cattatttcagcccggtagacaaaatgccgctggtggaagttattccccatgcgggcacc
agcgcgcagacgatttcgactaccgtttcgctggcgaagaaacaggggaaaacggcgatt
gtggtgggcgatagcgccgggttctacgtaaatcgcattcttgcgccttatatcaacgag
gcggcgcgctgcctgctggccggtgaacctgtcgatcatatcgataatgcgctggtgaac
tttggcttccctgtcgggcccgttcagcttctcgacgaagtgggcattgatgtcggtacg
aaaatcggcccgattctggtggaagcgtttggtgaacgctttgctgcaccgtctggcttt
gacgccgttttacaagacgaccgcaaaggccgtaagaatggcaaaggtttttatctctac
ggtcagaaagggcgcgggacgaagaaaaagcaggtcgatccgtcggtctatcgtttactg
aatgtcacgccaaaagcgcagcagtcgggcgaagagatcgcacagcgctgcgtcatgctg
atgctgaacgaggccgtccggtgcctggatgaaaatgtgatccgcagcgcgcgtgatggt
gatctcggcgcagtatttggcattggttttccgccgtttcgcggcgggccgttccgttac
atcgacacgctcggtgctgccagcgtggtgaaaacgctggaacaactggcacaacgctat
ggcgaacattttacgccgtgcgaaggtctgcggcggcgggcagagcagggcgagcgtttc
tgtccctga

DBGET integrated database retrieval system