KEGG   Rahnella sp. ERMR1 05: BV494_02860Help
Entry
BV494_02860       CDS       T05331                                 

Definition
(GenBank) beta-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
rox  Rahnella sp. ERMR1:05
Pathway
rox00061  Fatty acid biosynthesis
rox01100  Metabolic pathways
rox01212  Fatty acid metabolism
Module
rox_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rox00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BV494_02860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rox01004]
    BV494_02860
Enzymes [BR:rox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BV494_02860
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     BV494_02860
Lipid biosynthesis proteins [BR:rox01004]
 Fatty acid synthase
  Component type
   BV494_02860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AVF33938
UniProt: A0A2L1UM85
LinkDB All DBs
Position
complement(651412..651930)
Genome map
AA seq 172 aa AA seqDB search
MVDKRDSYTKEDLVASGRSELFGAGGPPLPSGNMLMMDRIVKMQEDGGTHGKGYVEAELD
INPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLP
TAKLVTYRLNFKRVINRKLIMGVADGEVLVDGVVIYTATDLKVGLFKDAAAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacgcgattcctatacgaaagaagacctcgtagcttctggccgcagtgaa
ctgttcggtgcaggcggccctccattaccatcaggcaacatgctgatgatggaccgcatc
gttaagatgcaggaagatggcggcacccatggcaaaggctatgttgaagctgaattagat
atcaatcctgacctgtggttctttggttgccactttatcggtgatccggtcatgccgggt
tgtctgggtctggatgcaatgtggcagttggtcggcttctatctgggctggctcggtggc
gaaggcaaaggccgcgcactgggtgtgggtgaagtgaaattcaccggtcaggtattaccg
acggcgaagctggtcacttaccgcctgaacttcaaacgcgtgattaaccgtaaactgatc
atgggcgttgcggacggtgaggttctggttgacggcgtggttatctacaccgcaacggat
ctgaaagtcggtctgttcaaagacgccgcagcgttctaa

DBGET integrated database retrieval system