KEGG   Rahnella sp. ERMR1 05: BV494_07510Help
Entry
BV494_07510       CDS       T05331                                 

Definition
(GenBank) multidrug export protein EmrA
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
rox  Rahnella sp. ERMR1:05
Brite
KEGG Orthology (KO) [BR:rox00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rox02000]
    BV494_07510
Transporters [BR:rox02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   BV494_07510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 HlyD Biotin_lipoyl PASTA DUF4448 DUF4577 DUF4366 OEP
Motif
Other DBs
NCBI-ProteinID: AVF34791
UniProt: A0A2L1UPE0
LinkDB All DBs
Position
1689642..1690832
Genome map
AA seq 396 aa AA seqDB search
MTNDNNAKPSASDDARSEQSELDSSQVKSGEGHTQDQKVTNNEAEEPDEKRKGPGKKPLI
ILGIVVVVMLVVALVWWLMTKDQISTDDAFTEGDAVTIAPKIAGYVTNLAVKDNQFVHKG
DLLVEIDPRDATAQRDAAQAQLGLAVAQLHQAQVQYDLAKVQYPAQLAQAKAQQTRAEAS
LLNATADFRRQRGVDPRATTQQNIDSSSAQVRSAAADLENAKAQVQVASQVQLNIRQAET
NVEAREQQVEQAKAQLENATLNLSYAQVRAPFDGYVTKRNVQLGTLVQAGSSLFSVVSKE
IWIAANYKESQLERMRPGNKVEITVDAFPDIKLHGHVDSIQQGTGSRFSAFPAENATGNY
VKIVQRVPVKIVIDSGLDENHHLPLGLSVEPTVTVE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgataacaatgcaaaaccttccgcgtcagatgacgcacgttccgaacagtca
gaactcgattccagccaggtgaaatcaggagaaggccacacgcaggaccaaaaagtcacg
aataacgaggcagaagaaccggatgagaagcgcaaaggccccggcaagaaacccctgatt
attctcggtattgtcgtggtggtgatgctggtcgtggcgctggtctggtggctgatgacc
aaagatcagatcagcaccgacgatgcctttaccgaaggcgacgcggtgaccattgcgcca
aaaatcgccggttatgtgaccaacctggcggtgaaagataaccagtttgtgcataaaggc
gatctgctggtggaaattgatccgcgtgatgccacggcgcaacgcgatgccgcgcaggcg
cagcttgggctggcggtggcacagctccatcaggcgcaggttcagtatgatctggcgaaa
gtgcagtatccggcgcaactggcgcaggccaaagcccagcagacgcgtgcggaagccagc
ctgcttaacgccacggcagatttccgtcgtcagcgcggtgtcgatccgcgggcgaccaca
caacagaatatcgactcgtccagcgcgcaggtgcgttctgctgctgccgatctggaaaat
gccaaagcgcaggtgcaggttgcctcgcaggttcagctcaatattcgtcaggctgaaacc
aacgtcgaggcccgcgagcaacaggttgaacaggccaaagcgcagctcgaaaacgccacg
ctgaatctttcgtatgcgcaggttcgcgcaccgttcgacggctacgtcaccaagcgtaat
gtgcagctcggcacgctggtgcaggccggttcttcgctgttctcggtggtgtcgaaagag
atctggatcgccgccaactacaaagaatcgcagcttgagcggatgcgtccgggcaataaa
gttgaaatcaccgtggacgcgttcccggacatcaaacttcacggccacgttgacagtatc
cagcaaggcaccggctcgcgcttctcggccttcccggcggaaaatgccaccggtaactac
gtgaaaattgtgcagcgcgtgccggtcaaaatcgtcatcgacagcggtctggatgaaaat
catcatctgccgctcggcctgtctgttgaaccgacggtgaccgtcgaatga

DBGET integrated database retrieval system