KEGG   Rahnella sp. ERMR1 05: BV494_08620Help
Entry
BV494_08620       CDS       T05331                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rox  Rahnella sp. ERMR1:05
Pathway
rox00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rox00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BV494_08620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rox02000]
    BV494_08620
Enzymes [BR:rox01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BV494_08620
Transporters [BR:rox02000]
 Other Transporters
  Pores ion channels [TC:1]
   BV494_08620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_2 GST_N_3 GST_C_3 GST_C_2 Tom37 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AVF34996
UniProt: A0A2L1UPY3
LinkDB All DBs
Position
1912725..1913330
Genome map
AA seq 201 aa AA seqDB search
MKLYYKPGACSLSPHIVLREAGLDFSIEKVDLATKKTETGDDFLTVNPKGQIPTLLLSDG
SILTEGVAIVQYLADQKPDRQLMPEQGTLARYHALEWLNYIATELHKGFSPLFNPKTPDE
FKALTREALSKKFAYVNESLKGHPFLLGARFSVADAYLFTVMGWAKALKFDFTALTELNA
YLERVAARPAVDAAMKAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtattacaaacccggtgcctgttccctttctccacatattgtcctgcgtgaa
gcgggtctggatttcagtattgagaaagtcgatctggcgaccaagaagacggaaaccggt
gatgacttcctgaccgtgaacccgaaagggcagatcccgacgctgctgctcagtgacggc
agcattctgaccgaaggcgttgccatcgttcagtatctggctgaccagaaacctgaccgc
cagctgatgccggagcaaggtacgctggcccgctatcacgcgctggaatggctgaactat
attgcgaccgagctccacaaaggtttttcgccgctgttcaacccgaaaacgcctgacgaa
ttcaaagcgctgacccgcgaagcattgagcaaaaaatttgcgtacgtgaatgaatctctg
aaaggtcaccccttcctgctgggtgcacgtttcagcgtagccgatgcgtatttgttcacc
gtgatgggctgggcgaaagcgctgaagtttgatttcacggcgctgaccgagctgaatgct
tatctggagcgcgttgcagcgcgtccggcggttgacgcggccatgaaggctgaaggcctg
aaataa

DBGET integrated database retrieval system