KEGG   Rouxiella sp. ERMR1 05: BV494_10310Help
Entry
BV494_10310       CDS       T05331                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rox  Rouxiella sp. ERMR1:05
Pathway
rox00473  D-Alanine metabolism
rox00550  Peptidoglycan biosynthesis
rox01100  Metabolic pathways
rox01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rox00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BV494_10310
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BV494_10310
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BV494_10310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rox01011]
    BV494_10310
Enzymes [BR:rox01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BV494_10310
Peptidoglycan biosynthesis and degradation proteins [BR:rox01011]
 Precursor biosynthesis
  Amino acid ligase
   BV494_10310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: AVF35300
UniProt: A0A2L1UQS6
LinkDB All DBs
Position
complement(2247720..2248817)
Genome map
AA seq 365 aa AA seqDB search
MSKLRVGIIFGGKSAEHEVSLQSAKNIVDAIDKERFDVTLLGIDKKGEWHINDASNYLIN
AENPSLIALNRSNNQVALIPGQTENQLIETHSASALSQVDVVFPIVHGTLGEDGSLQGLL
RMANIAFAGSGVLGSAVSMDKDVTKRLLRDAGLSVAPFVTLTRANRQKYTFAEVSKQLGL
PLFIKPANQGSSVGVSKVSNEAGFLNALETAFSFDHKVLVESAIKGREIECAVLGNDYPQ
ASVCGEVILHDEFYSYDTKYINEAGASIAVPADLPQETHDRIRAIALQAFQVLECRGMAR
VDVFLTEQGDVVINEINTLPGFTNISMYPKLWAASGLNYSDLITRLIELALEQHEQDNQL
KSSAN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaattacgggtaggcatcatttttggcggcaaatcggcagagcacgaagtgtca
ttacaatcggcaaaaaatattgtggatgccattgataaagaacgctttgacgtgacgttg
ctgggcattgataagaaaggcgagtggcatattaacgatgccagcaactacctgatcaat
gctgaaaatccgtcactgattgccctgaaccgctcaaataatcaggtcgcgctcattccg
gggcagacagaaaatcagctgattgaaacgcacagcgccagcgcattgtcgcaggtggac
gtggtcttcccgattgttcacggcacgctgggcgaagatggctcattgcagggcctgctg
cgcatggcgaatattgcgttcgccggttccggcgtactgggttcggccgtcagcatggat
aaagatgtgaccaagcgtctgttgcgggacgcgggtttgtccgttgcgccctttgtcacc
ctgacccgtgcaaaccgccagaaatatacgttcgctgaagtctctaagcagctcggttta
ccgctgtttatcaaacctgctaatcagggatcgtccgttggcgtcagcaaagtgagcaac
gaagcaggtttcctgaatgcgctggaaactgcgttcagcttcgaccacaaagtgttggtg
gagtccgcgatcaaaggccgcgaaattgaatgcgcggtactcggcaatgattacccgcag
gccagcgtatgcggcgaagttatcctgcacgacgagttttattcttacgacaccaagtac
attaatgaagcgggtgcatcgattgccgttcccgccgatttaccacaggaaacccatgac
cgcatccgggccatcgcattgcaggcgtttcaggtgctggaatgccggggtatggcgcgc
gtcgatgtgttcctgaccgagcagggcgacgtcgttatcaacgaaatcaacacgctgccg
ggttttaccaacatcagcatgtacccgaaactgtgggcggccagcggtttaaattacagt
gatctgatcacgcgcctgatcgaactggcgctggagcaacacgagcaagataaccagctc
aaaagctcagccaactga

DBGET integrated database retrieval system