KEGG   Rahnella sp. ERMR1 05: BV494_12380
Entry
BV494_12380       CDS       T05331                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
rox  Rahnella sp. ERMR1:05
Pathway
rox00052  Galactose metabolism
rox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BV494_12380
Enzymes [BR:rox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     BV494_12380
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C TrkA_N 2-Hacid_dh_C Sacchrp_dh_NADP 3HCDH_N Shikimate_DH Methyltransf_25 ELFV_dehydrog UDPG_MGDP_dh_N Pyr_redox_2 Methyltransf_31 MTS PglD_N PrmA Pyr_redox Met_10
Other DBs
NCBI-ProteinID: AVF35673
UniProt: A0A2L1URU2
LinkDB
Position
2674418..2675467
AA seq 349 aa
MQSVVVHQGGSITVEEREKPMLSAPDDVLVRVAYSGLCGSDIPRIFANASHYYPITLGHE
FSGYVVSAGDEVHDLQEGDAVACVPLLPCFHCEECKKEAYSQCKHYQFIGSRRDGGHAEY
VVASRKNLFRLPENASLLQGAFLEPITVGLHALKLAGGCEGKEVVVIGAGTIGQLIIQAA
SALGAKSVTAIDINPQRLDLALSSGASHSFNSAQLNADEIRHQSQERRFNQLIIETAGTP
QTVALALDIAGPKAQIALVGTLHKDLTLNVATFSHILRKELTLLGSWMNYSAPWPGSEWQ
QATQLFAEQKINLTPLIGCLGDAQEFANEVAALKGKPMAGKILLDLTRS
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcaatctgtagtggtacaccagggcgggtcaatcaccgtcgaggaacgggaaaaaccc
atgctaagcgcgccggacgatgtgttagtgcgggtggcgtattccggcctgtgcggttct
gatattccgcgcatttttgccaacgcctcacattactacccgatcacgctcggccatgaa
tttagcggttacgtggtcagcgctggcgatgaagttcatgatttacaggaaggtgatgct
gtggcgtgcgttcctctgctcccctgctttcactgtgaagaatgcaaaaaagaagcgtat
tcacaatgtaagcactatcagtttatcggctcacgtcgcgatggcggccatgctgaatat
gtcgtcgcgtcgagaaaaaatctcttccggctgccggaaaacgcgtcgctgttgcagggc
gcatttctggaaccgatcactgtggggttgcacgcactaaaactggccggaggctgtgaa
ggaaaagaagtcgttgtgattggtgcgggcacgatcggccagctgatcattcaggcggcc
agcgccctgggggcaaaatccgtaacggctattgatatcaaccctcagcgtttggatctc
gccctgagctccggcgcgagccatagctttaacagcgcccaactgaacgccgatgaaatt
cgtcatcaaagtcaggaacgtcgctttaatcaactgattatcgaaaccgctggcacaccg
cagactgtcgcgctggctctcgacattgcgggtccgaaagcgcagatcgcgctggtcggc
acactgcataaagatctgaccctgaatgtggcgacgttcagccacatcttgcgtaaagag
ctgacgttactcggcagctggatgaattattccgcaccctggcccggcagcgaatggcag
caggcaacgcaacttttcgcggagcaaaaaataaatctgacgccgttaattggctgtctg
ggcgacgctcaggaatttgcgaatgaagtcgccgccctgaagggaaaacctatggcgggc
aaaatcctgctggatttaacaaggagctaa

DBGET integrated database retrieval system