KEGG   Rahnella sp. ERMR1 05: BV494_13470Help
Entry
BV494_13470       CDS       T05331                                 

Definition
(GenBank) peptidoglycan glycosyltransferase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
rox  Rahnella sp. ERMR1:05
Pathway
rox00550  Peptidoglycan biosynthesis
rox01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rox00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BV494_13470
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BV494_13470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rox01011]
    BV494_13470
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rox03036]
    BV494_13470
Enzymes [BR:rox01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BV494_13470
Peptidoglycan biosynthesis and degradation proteins [BR:rox01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BV494_13470
Chromosome and associated proteins [BR:rox03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BV494_13470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: AVF35876
UniProt: A0A2L1USE4
LinkDB All DBs
Position
complement(2913620..2915383)
Genome map
AA seq 587 aa AA seqDB search
MKATRTAKLKRPEDQASFISWRFALLCACILLALVGLMLRVAYLQVINPDKLVKEGDLRS
LRVQTIPTSRGMITDRSGRPLAVSVPVNAIWADPKEINDRGGITVDTKWKALADALNMPL
DQLSARINANPKGRFVYLARQVNPAVGEYVHKLKLPGISLRQESRRYYPAGQVTSHVIGV
TNIDGEGIEGVEKSFDRWLTGKPGERTIRKDRFGRVIEDISTVDSQAAHNLALSIDERLQ
ALVYRELNNAVAFNKAESGTAVLVDVQTGEVLAMANSPSYNPNNMPDTPKDVMRNRAITD
IFEPGSTVKPMVVMTALKNGVVRENSVLNTLPYRINGHEIKDVARYAELSVTGILQKSSN
VGVSRLALSMPSAELVDTYSRFGLGKPTNLGLVGESSGLYPKKQRWSDIERATFSFGYGL
MVTPLQLARVYATIGSMGIYRPLSITRVDPPVSGERVFPEPLVRTVVHMMESVALPGGGG
VKAAIKGYRIAIKTGTAKKVGPDGKYVNKYIAYTAGVAPASNPRYALVVVINDPQGGKYY
GGAVSAPVFGAIMGGVLRTMNVEPDALTADENADIVNNQKEATGGRS
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaacacgcaccgcgaagttaaagcgtcccgaagatcaagccagctttattagc
tggcgttttgcgttgttgtgcgcctgtatccttctggccctggtgggtctgatgttgcgt
gtggcttatctgcaagtcattaatccggacaaactggtcaaagaaggggatttacgttcc
ctgcgcgttcagaccatccccacatcccgcggcatgattaccgaccgctctggtcgtcct
ctggcggtaagcgtgccggtcaatgcaatctgggccgacccgaaagaaattaacgatcgc
ggtggcatcacggttgataccaaatggaaagccctggccgatgcgctaaacatgccgctc
gatcaactttctgcccgcatcaatgcgaatccgaaaggccgtttcgtgtatctggcgcgt
caggtgaatccggccgttggcgaatatgtccataaactcaagctgccagggatttctctg
cgtcaggaatcccgccgttattatccggccgggcaggttacatcgcacgtcattggcgtc
accaacattgacggtgaaggcattgaaggcgttgagaagagttttgaccgctggctgacc
ggcaaaccgggtgaacgtaccatccgtaaagaccgttttggccgcgtcattgaagatatc
tccaccgtcgacagccaggctgcccacaatctggcgctgagcattgacgaacgtctgcag
gcgctggtgtaccgcgaactcaataacgccgtggccttcaataaagcggaatccggcacg
gcggtgctggtcgatgtgcaaaccggcgaagtgctggcgatggccaacagcccgtcctat
aacccgaacaacatgccggatacgccgaaagacgtgatgcgtaaccgtgcaatcactgac
atcttcgaaccgggttctaccgtgaaaccgatggtcgtcatgaccgcgttgaagaatggt
gtggtccgtgagaacagcgtgctcaatacgctgccgtaccggatcaacggccatgagatt
aaagatgtggcccgttacgcggagctttccgtgacgggtatcttgcagaagtcgagtaac
gtcggtgtttcacgactggcgttatcgatgccatccgcagagctggtagacacttactcg
cgattcggattgggaaaaccgaccaatttggggctggttggagaaagcagtggcttatac
cctaaaaaacaacggtggtctgacatagagagggccaccttctctttcggctacgggcta
atggtgacacctctccagctagcgcgagtctatgccacgatcggcagtatgggcatctat
cgcccgttgtcgatcacacgcgttgatcccccggtttccggtgaacgtgtgttcccggaa
cctttggtgcgcaccgtcgttcatatgatggaaagcgttgcgctgccgggcggcggcggc
gtgaaagccgcgatcaagggttaccgtattgcgattaaaaccggtactgcgaagaaagtc
ggtccggacggcaaatacgtcaataaatacattgcttataccgccggtgttgcgccggca
agcaacccaagatatgccctggtggtcgtgattaacgatccgcagggcgggaagtattac
ggtggggccgtttccgcaccggtgtttggcgccatcatgggcggggtgttgcgtaccatg
aacgttgaacctgacgcgctgactgccgatgaaaatgcagacatagtaaataatcaaaaa
gaggcaacaggtggcagatcgtaa

DBGET integrated database retrieval system