KEGG   Rahnella sp. ERMR1 05: BV494_15655Help
Entry
BV494_15655       CDS       T05331                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rox  Rahnella sp. ERMR1:05
Pathway
rox00564  Glycerophospholipid metabolism
rox01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rox00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BV494_15655
Enzymes [BR:rox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BV494_15655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N GIDA HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AVF36275
UniProt: A0A2L1UTK6
LinkDB All DBs
Position
3382059..3383570
Genome map
AA seq 503 aa AA seqDB search
METKDLIVIGGGINGTGIAVDAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHQPHLRPAWMIRAGLFLYDHLGKRTSLPAS
KGLKFGSESVLKPELTKGFEYSDCWVDDARLVVVNAQEVEERGGEVRTRTRVTRAWREDG
LWMVEAEDIDTGKTFTWRAKGLVNATGPWVKHFFDDGLKLKSPYGIRLIKGSHIVVPRAH
NQPQAYILQNEDHRIVFVIPWLDEFSIIGTTDVEYHGDPKDVKIDDNEVSYLLKVYNDHF
KKQLTTEDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVHDQDGKAPLLSVFGGKLTTYRK
LAEHALEKLVKYYPKAGPAWTKTAVLPGGKLNGDRDTYSANLRNRFKWLPESLARRYART
YGSQTELFLNDATGIESLGEDFGHGLYEAELRYLVEKEWVSQLDDAIWRRTKLGMWLDKA
QQQRVAEWLETHKQQKKHLSLAS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgtaattggtggcggtattaatggtaccggcatcgcagtc
gatgcagctggccgcgggctgtctgttctgctgcttgaagcgcaagacttggcctgcgcg
acctcttcggccagttctaaactgatccacggtggcctgcgttacctggaacactacgaa
ttccgtctggtcagcgaagcgctggctgaacgtgaagtgctgttaaaaatggcaccgcat
attgccttcccgatgcgtttccgtttaccgcatcagccgcatttgcgtccggcctggatg
atccgcgccggtctgttcctgtacgaccatctgggtaaacgtaccagcctgcccgccagt
aaaggcctgaaattcggcagcgaatcggtactgaaaccagaactgaccaaaggttttgaa
tactcagactgctgggttgacgatgcgcgcttagtcgtcgtcaacgcgcaggaagtcgaa
gagcgcggcggcgaagtgcgcacccgcacccgcgtgacccgcgcatggcgtgaagacggt
ttgtggatggtggaagccgaagatattgataccggcaaaaccttcacctggcgcgccaaa
gggctggtgaatgccaccggtccgtgggtcaaacatttcttcgacgacggcctgaagctg
aaatcgccgtacggcatccgtctgatcaaaggcagccatattgtggttccgcgcgcacac
aatcagccgcaggcgtacattctgcaaaacgaagatcaccgcattgtgttcgtgatcccg
tggctggatgagttctcgattatcggcaccaccgacgtggaatatcacggcgatccgaaa
gacgtaaaaatcgacgataacgaagtgagctatctgctgaaagtgtataacgaccacttt
aaaaagcagctgaccaccgaagatatcgtctggacttactccggcgtgcgtcctctgtgc
gacgatgagtccgattctccgcaggcggttacccgcgattacactctggatgttcacgat
caggatggcaaagcgccgctgctttctgtgtttggcggcaagctcaccacctaccgtaaa
ctggccgagcacgcgctggaaaaactggtgaagtactacccgaaagccggtccggcctgg
acgaaaaccgccgttctgcctggcgggaagctgaatggcgatcgcgatacgtacagcgcc
aatctacgcaaccgctttaaatggttgccggaatcactggcccgccgttatgcccgtacc
tacggcagccagacggaactgttcctgaatgacgcgaccggcattgaatcgctgggcgaa
gatttcggtcacggtttatatgaagccgaattgcgctacctggtcgaaaaagagtgggtc
tcacagctcgatgacgccatctggcggcgtaccaaactcggtatgtggctggataaagcg
cagcaacagcgtgtcgccgaatggctggaaacacacaaacagcagaagaaacatctgtcg
ctggcgtcgtaa

DBGET integrated database retrieval system