KEGG   Rahnella sp. ERMR1 05: BV494_17745
Entry
BV494_17745       CDS       T05331                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
rox  Rahnella sp. ERMR1:05
Pathway
rox00521  Streptomycin biosynthesis
rox00523  Polyketide sugar unit biosynthesis
rox00525  Acarbose and validamycin biosynthesis
rox01100  Metabolic pathways
rox01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rox00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BV494_17745
   01055 Biosynthesis of vancomycin group antibiotics
    BV494_17745
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BV494_17745
   00525 Acarbose and validamycin biosynthesis
    BV494_17745
Enzymes [BR:rox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     BV494_17745
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 3Beta_HSD adh_short Sacchrp_dh_NADP KR
Other DBs
NCBI-ProteinID: AVF36655
UniProt: A0A2L1UUP1
LinkDB
Position
3853847..3854914
AA seq 355 aa
MNKILITGGAGFIGSAVVRHIIHNTQDFAIVVDKLTYAGNLDSLAEISADPRYAFEQVDI
NDRAALDSVFLHYQPDAVMHLAAESHVDRSIDSPAAFIETNVVGTYQLLEAARQYWLTLS
EPARKVFRFHHISTDEVFGDLQATDAQFTESTLYAPSSPYSASKAASDHLVRAWLRTYGL
PTLVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGDGGQIRDWLYVEDHARALYQVL
AKGGVGETYNIGGHNERKNIEVVEGICALLEELVPQKPSNVEHYRDLITFVKDRPGHDLR
YAINADKIEHELGWKPEETFETGLRKTVMWYLNNQTWWQRVQNGGYRGERLGLKG
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgaataaaatactgatcactggtggcgcaggctttatcggttctgccgttgtcagacat
attattcataacacacaagatttcgcgattgttgtcgataagctgacttatgcgggcaac
cttgattcacttgctgagatttcggctgatccacgttacgcattcgagcaagttgatatt
aatgatcgtgctgcattggattctgtgtttttgcattatcagccagacgcggtgatgcat
ttggctgccgaaagtcatgtcgatcgttctatcgacagccccgcagcttttatcgaaacc
aacgtggtgggtacatatcaactgctggaagccgcccgccagtactggctgacgctgtca
gaacctgcacgcaaggtgtttcgttttcatcatatttctacggacgaagtgtttggtgat
cttcaggcgactgatgctcagtttactgaatccacactttatgcgccgagcagcccctat
tcagcttcaaaagctgccagtgatcaccttgtgagagcatggttgcgtacctatggattg
ccgacgttagtcactaattgttctaataattatggaccttaccattttccagaaaaactg
atcccactcgttatcctcaatgcattagcaggaaagcctttaccggtttatggcgatggc
ggtcagattcgtgactggctctatgtggaagatcatgcgcgcgctttatatcaggttttg
gcgaaaggtggcgtaggggaaacgtataatattggtgggcacaatgaacgtaaaaatatt
gaggtggtagaaggcatctgtgcattgctagaggagcttgttccgcagaaaccgagcaat
gtagagcattaccgggatttaattaccttcgttaaagatcgcccaggacatgaccttcga
tacgcaatcaatgctgacaaaattgagcatgaacttggctggaaaccggaagagactttt
gaaaccggtttacgtaaaactgtgatgtggtatctgaataaccaaacctggtggcaacgt
gttcaaaatggtggctatcgtggtgagcgtctgggccttaaaggctaa

DBGET integrated database retrieval system