KEGG   Rouxiella sp. ERMR1 05: BV494_23615Help
Entry
BV494_23615       CDS       T05331                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rox  Rouxiella sp. ERMR1:05
Pathway
rox00250  Alanine, aspartate and glutamate metabolism
rox00410  beta-Alanine metabolism
rox00640  Propanoate metabolism
rox00650  Butanoate metabolism
rox01100  Metabolic pathways
rox01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BV494_23615
   00650 Butanoate metabolism
    BV494_23615
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BV494_23615
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BV494_23615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rox01007]
    BV494_23615
Enzymes [BR:rox01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BV494_23615
Amino acid related enzymes [BR:rox01007]
 Aminotransferase (transaminase)
  Class III
   BV494_23615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AVF37873
UniProt: A0A2L1UY43
LinkDB All DBs
Position
unnamed1:complement(479869..481137)
Genome map
AA seq 422 aa AA seqDB search
MSHSELEKRRKEATPRGVGVMCDFYAAKAENATLWDEQGREYIDFTAGIAVLNTGHRHPK
IVEAIRKQLDLFTHTAYQIVPYASFVTLAERINEIAPVSGKAKTTFFSTGAEAVENAVKI
ARAATGRPGIITFSGAFHGRTLLTMALTGKVVPYKVGFGPFPASVFHGQYPNTQHGVSTE
MALESLERIFRSDISPQQVAAILYEPIQGEGGFNIAPEDFVKGLRDLCDRHGIVLIADEV
QSGFARTGKMFASDYYPNARPDLVTMAKSLGGGIPISGVTGRAELMDAPEPGGLGGTYAG
NPLAVASALAVLDIIKEEKLCERANRLGAELVETLEKAKATCPALVDVRARGSMVAAEFN
DPATGKPSAELTKQYLRKALDAGLLMLSCGVHGNVIRFLYPLTIPDAQFKDALAILSRVL
AD
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacagcgaactggaaaaacgccgtaaagaagcgacaccgcgtggtgtcggcgtc
atgtgtgatttctatgcagcgaaggcggaaaacgcaacgttgtgggatgagcagggccgt
gaatatatcgatttcaccgccgggattgccgtgctcaataccggccaccgccatccgaaa
attgtcgaagcaatccgcaaacagctcgacctgttcacgcacaccgcctaccagattgtg
ccttatgcaagctttgttacgctggccgaacgcatcaacgaaatcgcgccggtatcagga
aaagccaaaaccaccttcttcagtaccggtgccgaagcggtagaaaacgcggtgaaaatt
gcccgcgctgccaccggtcgtcccggcattatcacgttctccggcgcattccacggccgc
accttactgaccatggcactgaccggcaaagtcgtgccgtacaaagtgggcttcgggcct
ttccctgcgtcggtattccacggccagtatccgaatacgcaacacggcgtcagcaccgaa
atggcgctggagagcctcgaacgtatattccgcagtgatatcagcccgcagcaggttgcc
gccattctttacgaaccgatccagggcgagggtggttttaacattgcgccggaagatttt
gtgaaaggtctgcgcgacctctgtgaccgccacggcatcgtgctgattgcggatgaagtg
cagagcggttttgcacgtaccggtaaaatgttcgcgtctgattactacccgaatgcccga
ccggatttagtcaccatggcgaaaagtctgggcggcgggatcccgatttccggcgtgacc
ggccgcgctgaactgatggacgcgccggaaccgggcggtctgggcgggacatatgccggt
aatccgctggctgtcgcatcggcgctggccgttctggacattatcaaagaagaaaaactg
tgcgagcgtgccaaccgtctgggggcagaactggttgaaacgctggaaaaagccaaagcg
acatgtccggcgctggtcgatgtgcgtgcgcgcggttccatggtcgcggcagaattcaac
gacccggcgacaggaaaaccttccgctgaactaaccaaacagtatctgcgtaaagcgctg
gatgccggattactgatgctgagctgcggcgtccacggcaacgtgatccgcttcctgtat
ccgctgaccattccggatgcgcagttcaaagacgcgctggccattttatcccgcgtgctg
gctgactga

DBGET integrated database retrieval system