KEGG   Rhizobium oryzihabitans: G3A56_15470
Entry
G3A56_15470       CDS       T06770                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
roy  Rhizobium oryzihabitans
Pathway
roy00473  D-Alanine metabolism
roy00550  Peptidoglycan biosynthesis
roy01100  Metabolic pathways
roy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:roy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    G3A56_15470
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    G3A56_15470
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    G3A56_15470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:roy01011]
    G3A56_15470
Enzymes [BR:roy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     G3A56_15470
Peptidoglycan biosynthesis and degradation proteins [BR:roy01011]
 Precursor biosynthesis
  Amino acid ligase
   G3A56_15470
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 GARS_A ATP-grasp_3 CPSase_L_D2
Other DBs
NCBI-ProteinID: QIB39221
LinkDB
Position
M15-11:3085451..3086377
AA seq 308 aa
MSGKHVAVLMGGFSSERPVSLSSGNACALALEGEGYKVTRVDVGRDVAAVLDELRPDVAF
NALHGPFGEDGTIQGILEYLVIPYTHSGVLASALAMDKAQAKKVAAAAGVPVAVERVMNR
FDFTSEHPLSPPYVVKPVREGSSFGVVIVKEDQSHPPQILTSSEWRYGDQVMVERYIHGR
ELTCGVLDGEALGVTEVVPLGHNFYDYDAKYAAGGSKHVIPAEISPKIYQKIQTLAVMAH
QAIGCRGVSRSDFRYDDRFSEDGEVIWLEVNTQPGMTPTSLVPEMAAHAGRSFGNLVSWM
VEDASCLR
NT seq 927 nt   +upstreamnt  +downstreamnt
atgagcggcaagcacgtagctgttcttatgggtgggttttcttcggagcggccggttagc
ctgtcgtcggggaacgcttgcgcgctcgcccttgagggtgaggggtacaaggttacccgt
gtcgacgtgggccgcgatgtcgccgccgtgctcgatgaattgcgtcccgacgtcgccttc
aatgccctgcacgggcctttcggtgaagatggcaccattcagggcattctcgaatatctt
gtcattccctatacccattccggcgtgcttgcttcggcgctcgccatggacaaggcgcag
gctaagaaagtggccgcggctgccggtgttccggttgcagtcgagcgcgtcatgaaccgc
ttcgatttcaccagcgagcatccgctttcgcctccctatgtggtgaagccggtgcgcgaa
ggttcgagcttcggtgttgtcatcgtcaaggaagaccagtcgcatccgccgcagattctt
acctcgtcggaatggcgttacggcgatcaggtgatggtcgagcgctatattcatggccgc
gaactgacctgcggtgtgcttgacggcgaggcgcttggcgtcacggaagtggtgccgctc
ggtcacaatttctatgattatgacgctaaatacgctgccggtggctcaaagcatgtcatt
ccggcagaaatttcaccgaaaatttaccaaaaaattcaaacactggcggttatggcacat
caggcgatcgggtgccgtggcgtaagccgttcagactttcgttacgacgaccgcttctca
gaagatggcgaagttatctggcttgaagtgaatacgcagccgggcatgacgccgacctcc
ctggtgccggaaatggcggctcatgctggccgctcctttggtaaccttgtcagctggatg
gtggaggacgcttcgtgtttgcggtga

DBGET integrated database retrieval system