KEGG   Rhodopseudomonas palustris CGA009: RPA0023Help
Entry
RPA0023           CDS       T00153                                 

Gene name
gstA3
Definition
(GenBank) possible glutathione transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rpa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RPA0023 (gstA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpa02000]
    RPA0023 (gstA3)
Enzymes [BR:rpa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RPA0023 (gstA3)
Transporters [BR:rpa02000]
 Other Transporters
  Pores ion channels [TC:1]
   RPA0023 (gstA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: CAE25467
CyanoBase: RPA0023
CYORF: RPA0023
UniProt: Q6NDT1
LinkDB All DBs
Position
25362..26123
Genome map
AA seq 253 aa AA seqDB search
MSRAAETLLRRCAFSRLVPLQSLTDIRDHRDMLTVHHLNNSRSQRVLWLLEELDTPYEIK
RYQRQPDMMAPKELRAVHPLGKSPVITDNGNTIAESGAIIEYIVGTYGNGRLIPPPNTPE
RLRYTYWLHYAEGSAMPPLLLKLLFSMMPQRAPALVRPLVKMVASGALTGFVDPQLKLHM
DYWESELGKAAYFAGDEFTAADIQMSFPLEAAAARGGLDQRYPKAQAWLERIHARPAYNR
ALEKGGPYEIGKA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcgccgcggaaactctgctaaggcggtgcgcgttctcacggctggtgccgctt
caatcactgacagacatccgggatcatcgcgacatgctgaccgtccatcatctcaacaac
tcccgctcgcaacgcgtgctgtggctcctggaggagctcgacaccccttacgagatcaag
cgctatcaacgtcagccggacatgatggcgccgaaggagctgcgcgccgttcatccgctc
ggcaagtccccggtgatcaccgacaacggcaacaccatcgccgagtccggcgcgatcatc
gaatacatcgtcggcacctatgggaacggccggctgatcccgccgccgaacacgccggag
cggctgcgctacacctactggctgcactacgccgagggttcggcgatgccaccgctgcta
ctgaaattgctgttttcgatgatgccgcaacgcgccccggcgctggtgcggccgctggtg
aagatggtggcgtccggcgcgctgaccggcttcgtcgatccgcagctcaagctgcacatg
gattattgggagagcgaactcggcaaggccgcgtatttcgctggcgacgagttcaccgcc
gctgatatccagatgagcttcccactggaggccgccgccgcacgcggcggcctcgatcag
cgctacccgaaggcgcaggcgtggctcgaacgcatccacgcccgccctgcctacaaccgc
gcgctggaaaaaggcggaccgtacgaaatcggcaaggcgtag

DBGET integrated database retrieval system