KEGG   Rhodopseudomonas palustris CGA009: RPA0217Help
Entry
RPA0217           CDS       T00153                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00020  Citrate cycle (TCA cycle)
rpa00190  Oxidative phosphorylation
rpa00650  Butanoate metabolism
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01120  Microbial metabolism in diverse environments
rpa01130  Biosynthesis of antibiotics
rpa01200  Carbon metabolism
Module
rpa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rpa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPA0217 (sdhA)
   00650 Butanoate metabolism
    RPA0217 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RPA0217 (sdhA)
Enzymes [BR:rpa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RPA0217 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     RPA0217 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: CAE25661
CyanoBase: RPA0217
CYORF: RPA0217
UniProt: Q6ND92
LinkDB All DBs
Position
complement(242052..243875)
Genome map
AA seq 607 aa AA seqDB search
MAANVNGAPAAGGNAYPIEDHTYDVVVVGAGGAGLRAVVGCSEAGLRTACITKVFPTRSH
TVAAQGGISASLGNMHKDDWRWHMYDTVKGSDWLGDQDSIEYMVRNAPEAVYELEHWGVP
FSRTEDGKIYQRPFGGMTMDFGKGQAQRTCAAADRTGHAMLHTMYGQALRHSAEFYIEFF
AIDLIMDDQGCCRGVVALKLDDGTIHRFKAQTTILATGGYGRAYASCTSAHTCTGDGGAM
ALRAGLPLQDMEFVQFHPTGIYGSGCLVTEGARGEGGYLVNSEGERFMERYAPSAKDLAS
RDVVSRAMTIEMREGRGVGKKKDHIFLHLDHLAPEVLHERLPGISESARIFAGVDVTREP
IPILPTVHYNMGGIPTNFHGEVVTKKDGDDNAVVPGLMAIGEAACVSVHGANRLGSNSLI
DLVVFGRAAALRCAEKLVPNGKQPELPASSADMSLSRLDKYRYAKGGTPTAKLRERMQHV
MQNNCAVFRTGEVLAEGKELIANVHGSVGDVGVSDRTLVWNSDLVETLEFDNLIVQAVVT
MNSAANRTESRGAHAREDFPDRDDANWMKHTLAWIGDKGDVTIDYRPVHDYTMTNDVQYI
PPKPRVY
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaacgtcaacggcgccccggcggcgggcggcaacgcctatccgatcgaggac
cacacctacgatgtcgtggtggtcggcgccggcggcgcgggtttgcgcgcggtggtcggc
tgcagcgaagcgggcctccgcaccgcctgcatcaccaaggtgttcccgacccgctcgcac
accgtggcggcccagggcggcatctcggcctcgctcggcaacatgcacaaggatgactgg
cgctggcacatgtacgacaccgtgaaggggtcggactggctcggcgaccaggactcgatc
gaatacatggtccgcaatgccccggaagccgtgtacgaactcgagcattggggtgtgccg
ttctcgcgcaccgaagacggtaagatctatcagcggccgttcggcggcatgacgatggat
ttcggcaagggccaggcgcagcgcacctgcgcggccgccgaccgcaccggccacgccatg
ctgcacacgatgtacggtcaggcgctgcgccactcggctgagttctacatcgagttcttt
gccatcgacctgatcatggacgatcaggggtgctgccgcggcgtcgtggcgctgaagctc
gacgacggcaccatccatcgtttcaaggcgcagaccaccatcctggcgaccggcggctac
ggccgtgcctacgcttcctgcacgtcggcgcacacctgcacgggcgacggcggcgcgatg
gcgctgcgcgccggcctgccgctgcaggacatggagttcgttcagttccacccgaccggc
atctacggctcgggctgtctggtgaccgaaggcgcccgcggcgagggtggctatctggtc
aactccgagggcgagcgcttcatggagcgctatgcgccgtcggccaaggatctcgcctcg
cgcgacgtcgtttcgcgcgcgatgacgatcgaaatgcgcgaaggtcgcggcgtcggcaag
aagaaggaccacatcttcctgcacctcgaccatctggcgccggaagtgctgcacgagcgg
ctgccgggcatctcggaatcggcacggatcttcgccggcgtcgacgtcacccgcgagccg
atcccgatcctgccgaccgtgcactacaacatgggcggcatcccgacgaacttccacggc
gaagtcgtgaccaagaaggacggcgacgacaacgcagtggtgccgggcctgatggcgatc
ggcgaagctgcctgcgtgtcggtgcacggcgccaaccgcctcggctccaactcgctgatc
gacctcgtggtgttcggccgcgccgcagcgctgcgctgcgccgagaagctggtgccgaac
ggcaagcagcctgaactgccggccagctccgccgacatgtcgctgtcgcggctcgacaag
tatcgctacgccaagggcggcaccccaaccgccaagctgcgcgagcggatgcagcacgtg
atgcagaacaactgcgcggtgttccgcaccggcgaagtgctcgccgagggcaaggaactg
atcgccaacgtccatggcagcgtcggcgacgtcggggtgtcggatcgcacgctggtgtgg
aattccgatctcgtcgagaccctggaattcgacaatctgatcgtccaggcggtggtgacg
atgaactccgccgccaaccgcaccgagagccgcggcgcccacgcccgcgaagacttcccg
gatcgcgatgacgccaactggatgaagcacacgctggcctggatcggtgacaagggcgac
gtgaccatcgattatcggccggtgcacgactacacgatgaccaacgacgtccagtacatc
ccgccgaagccgcgggtgtattga

DBGET integrated database retrieval system