KEGG   Rhodopseudomonas palustris CGA009: RPA0650
Entry
RPA0650           CDS       T00153                                 

Gene name
badK
Definition
(GenBank) cyclohex-1-ene-1-carboxyl-CoA hydratase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00362  Benzoate degradation
rpa01100  Metabolic pathways
rpa01120  Microbial metabolism in diverse environments
rpa01220  Degradation of aromatic compounds
Module
rpa_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:rpa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPA0650 (badK)
Enzymes [BR:rpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     RPA0650 (badK)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: CAE26094
CyanoBase: RPA0650
CYORF: RPA0650
UniProt: G3XCR2
LinkDB
Position
complement(717848..718624)
AA seq 258 aa
MSSNPILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRA
FAAGADIASMAAWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIV
IAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRV
VDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADA
REGIQAFLEKRAPCFSHR
NT seq 777 nt   +upstreamnt  +downstreamnt
ttgtcgtccaatcctatcctcaccgaaacccagggccgggtcggcatcatcacgctgaac
cggccggatgtgctcaacgcgctcaacgatgccctgatggatgcgctcggcggcgcgctg
ctggcgttcgacgccgacgacggcatcggcgcgatcgtgatcgccggcaatacccgggcc
ttcgcggccggcgccgacatcgcctcgatggcagcatggagctatagcgacgtctatggc
tcgaacttcatcacccgcaattgggaaacgatccgccaaatacggaagccggtgctggcc
gcggttgccggcctcgcctatggcggcggctgcgagctggcactcgcctgcgacatcgtg
atcgctggccgcagcgccaagttcgcgctgccggaaatcaagctcggcctgctgcccggc
gccggcggcacgcaacgattgccgcgcgcgatcggtaaggccaaggcgatggacatgtgc
ctgtcggcgcggccgctcaacgccgaagaggccgatcgctatggtctggtctcccgcgtc
gtcgatgacgacaggctgcgtgacgagaccgtcgcgctggccaccacgatcgcggcgttc
tccgctccggcgctgatggcgctgaaggaaagcctcaatcgcgccttcgaaagcacgctc
gccgaaggcatcctgttcgaacgccgcgaactgcatgcccgcttcgccagtgccgacgcc
cgcgagggcattcaggcgttcctggagaagcgcgcaccgtgcttctcccaccgctag

DBGET integrated database retrieval system