KEGG   Rhodopseudomonas palustris CGA009: RPA0802Help
Entry
RPA0802           CDS       T00153                                 

Definition
(GenBank) possible DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa03030  DNA replication
rpa03410  Base excision repair
rpa03420  Nucleotide excision repair
rpa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RPA0802
   03410 Base excision repair
    RPA0802
   03420 Nucleotide excision repair
    RPA0802
   03430 Mismatch repair
    RPA0802
Enzymes [BR:rpa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RPA0802
    6.5.1.6  DNA ligase (ATP or NAD+)
     RPA0802
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     RPA0802
DNA replication proteins [BR:rpa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    RPA0802
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     RPA0802
DNA repair and recombination proteins [BR:rpa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     RPA0802
   NER (nucleotide excision repair)
    Other NER factors
     RPA0802
   MMR (mismatch exicision repair)
    Other MMR factors
     RPA0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-ProteinID: CAE26246
CyanoBase: RPA0802
CYORF: RPA0802
UniProt: Q6NBM6
LinkDB All DBs
Position
complement(888628..890493)
Genome map
AA seq 621 aa AA seqDB search
MNRFAELLDRLGYEPGRNNKLRLITNYFREVEDPDRGWALAALTGALSFRHAKPGLIRAL
IAERTDPVLFGLSYDYVGDLSETVALMWPSPRNTAVSSSPGWASSPPPCGEGSGVGVHDE
TPSSERPHPTPLPQAGEGARPASGEDVASQRQLISTGHNNPPPPTLTEIVTTLHSLGKAE
LPAQLARWLDELDEIGRWALLKLVTGALRIGVSARLAKTAAAALGDKDPHDVELVWPGLQ
PPYRELFAWLEDRGPQPVNRDPAPFRPVMLAHAIDDTDFAAINPADYIAEWKWDGIRVQA
VSGQNEHGDTVVRLYSRSGEDITMSFPDLLPSLHLPGAIDGELLVLRDKRVQSFNVLQQR
LNRKSVTPKLTKDYPIHLRAYDLLGEGDEDLRTLPFAERRARLETFIARLDDPKVDLSPI
VTFDDWEALRAARRDPASAGAGLDADAVEGVMLKRRDALYLPGRPKGQWWKWKHDPHIID
AVLMYAQRGHGKRSSYYSDYTFGVWTEGDAGDQLVPVGKAYFGFTDEELLQIDRFVRRNT
TEKFGPVRHVVHEPDKGLVLEVAFEGLQRSPRHKSGVAMRFPRINRLRWDKPPKDADRLE
TLERMLKAETTNPPATSARGH
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcttcgccgaactgctcgaccgcctcggctatgagcccggccgcaacaacaag
ctgcggctgatcaccaattacttccgcgaggtcgaggacccggatcgcggctgggcgctg
gcagcgctgaccggcgcgctgtcgttccgccacgccaagcccggcctgatccgcgccctg
atcgccgaacgcaccgacccggtgctgttcggcctgtcctacgactacgtcggcgatttg
tcggagacggtggcgttgatgtggccctctccccgcaacacggccgtctcctcttcccca
ggctgggcctcctcccctcccccctgcggggaggggtcgggggtgggggtccacgatgag
acgccatcctcggagcgccctcaccccacccctctcccgcaagcgggagagggagctcgc
cccgcaagtggcgaggatgtcgcttcacagaggcaactaatcagcaccggccacaacaac
ccgcctcccccgacgctcaccgagatcgtcaccacgctgcatagcctcggcaaggctgag
ctgccggcgcagctggcacggtggctggatgagctcgacgagatcggacgctgggcgctg
ctgaagctggtgaccggcgcattgcggatcggcgtatcggcgcggctcgcgaagaccgcg
gctgcggcgctcggcgacaaggacccgcacgacgtcgaactggtgtggccaggtctccag
ccgccatatcgcgagctgttcgcctggctcgaagaccgcgggccgcagccggtcaatcgc
gatccggcgccgttccgcccggtgatgctggcgcatgcgatcgacgacaccgacttcgcc
gcgataaatccggccgactacatcgccgaatggaaatgggacggcatccgggtccaggcg
gtcagcggccagaacgagcacggggacacggtcgtgcggctgtattcgcggagcggcgaa
gacatcaccatgagcttccccgatctgttgccgtcgctgcatcttcccggcgccatcgat
ggcgagctcctggtgctgcgtgacaagcgcgtgcaatcgttcaacgtgctgcagcagcgg
ctgaaccgtaaatcagtcacgccgaagctgacgaaggactatccgatccatctgcgcgcc
tatgacctgctcggcgaaggcgacgaggacctgcgaacactgccgttcgccgagcgacgc
gcccgcctcgagaccttcatcgccaggctcgacgatcccaaggtcgatctgtcgccgatc
gtcaccttcgacgattgggaagccttgcgcgcggcacgccgcgatccggccagtgccggc
gccgggctcgatgccgacgcggtcgaaggcgtgatgctgaagcggcgtgacgcgctgtat
ctgcccggccgccccaagggccagtggtggaagtggaagcacgacccgcacatcatcgat
gccgtgctgatgtatgcgcagcgcggccacggcaaacgctcgtcgtattattccgactac
accttcggggtctggaccgaaggcgacgccggcgatcagctcgtgccggtcggcaaggcg
tatttcggcttcaccgacgaagagctgctgcagatcgaccgcttcgtccgccgcaacacc
accgagaaattcggccccgtccggcatgtcgtgcacgagcccgacaagggcctggtgctg
gaagtggcgttcgaaggattgcagcgctcgccgcgccataaatccggcgtagcgatgcgg
tttccccgcatcaaccggctgcgctgggacaagccgccgaaggacgccgaccggctggaa
acgctggagcggatgctgaaggcggagaccacaaatccgccggcgacctccgcccgcggc
cattga

DBGET integrated database retrieval system