KEGG   Rhodopseudomonas palustris CGA009: RPA0820Help
Entry
RPA0820           CDS       T00153                                 

Gene name
gst2
Definition
(GenBank) putative glutathionine S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rpa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RPA0820 (gst2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpa02000]
    RPA0820 (gst2)
Enzymes [BR:rpa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RPA0820 (gst2)
Transporters [BR:rpa02000]
 Other Transporters
  Pores ion channels [TC:1]
   RPA0820 (gst2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_2 GST_N_3 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: CAE26264
CyanoBase: RPA0820
CYORF: RPA0820
UniProt: Q6NBK8
LinkDB All DBs
Position
complement(917708..918319)
Genome map
AA seq 203 aa AA seqDB search
MKLYYSPGACSLSPHIALSEAGLPFDLVKVDIRAKKLENGDDYAAINPKGSVPALGLDDG
SVLTEGPAIVQYIADKEGSGKLAPANGSPERYRLQEWLNYISTDLHKSFGPLFAPTLGDD
AKNFFKDRIARHLGYVDKQLAGKDYLMGSSFTVADGYLFVILSWCDRMQIDLAPYPNLTA
YKARIAARPKVQAAMQSEGLLQV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtattattcacccggtgcatgttcgctgtcgccgcatatcgcgctcagcgag
gccggcctgccgttcgacctggtcaaggtcgacatccgggcgaagaagctggagaacggc
gacgactacgccgcgatcaatccgaaggggtcggtgcctgcgctcggcctcgacgacggc
tcggtgctgaccgagggaccggcgatcgtgcagtacatcgccgacaaggaaggctccggc
aagctggcgccggccaacggatcgccggagcgctaccggctgcaggaatggctgaactat
atctcgaccgacctgcacaagagcttcggcccgctgttcgccccgacgctcggcgacgat
gccaagaatttcttcaaggaccgcatcgctcgccacctcggctatgtcgacaagcagctc
gccggcaaagactatctgatgggctcgtcgttcacggtggccgacggctatctgttcgtg
atcctgagctggtgcgaccgcatgcagatcgatctggcaccgtatcccaacctcaccgcc
tacaaagcccgcatcgcggcgcggccgaaggtgcaggcggcgatgcagagtgaagggctg
ctgcaggtgtga

DBGET integrated database retrieval system