KEGG   Rhodopseudomonas palustris CGA009: RPA1559Help
Entry
RPA1559           CDS       T00153                                 

Gene name
cbbL
Definition
(GenBank) ribulose-bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00630  Glyoxylate and dicarboxylate metabolism
rpa00710  Carbon fixation in photosynthetic organisms
rpa01100  Metabolic pathways
rpa01120  Microbial metabolism in diverse environments
rpa01200  Carbon metabolism
Module
rpa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rpa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rpa_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RPA1559 (cbbL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RPA1559 (cbbL)
Enzymes [BR:rpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RPA1559 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N OMPdecase
Motif
Other DBs
NCBI-ProteinID: CAE27000
CyanoBase: RPA1559
CYORF: RPA1559
UniProt: Q6N9J0
LinkDB All DBs
Position
1731700..1733157
Genome map
AA seq 485 aa AA seqDB search
MNEAVTIRGKERYKSGVMEYKKMGYWEPDYEPKDTDVIALFRVTPQDGVDPIEAAAAVAG
ESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPNSLGQYFAYIAYDLDLFEPGSISNLTAS
IIGNVFGFKPLKALRLEDMRLPIAYVKTFQGPATGIVVERERMDKFGRPLLGATVKPKLG
LSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFQYCMEAVNKAQAQTGEIKGTY
LNVTAATMEDMYERAEYAKELGSIIVMIDLVIGYTAIQSMAKWARKNDMILHLHRAGHST
YTRQRNHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPATTKGYYDICREDFNPMTLEN
GLFFDQHWASLNKLMPVASGGIHAGQMHQLLHLLGEDVVLQFGGGTIGHPMGIAAGATAN
RVALEAMILARNEGRDYLHEGPEILAKAAQTCTPLKAALDTWKNVTFNYESTDTPDYAPT
PSVSV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagcagtcaccatccgcggcaaggaacgctacaagtccggcgtgatggaatac
aagaagatgggctattgggagcccgactacgagccgaaggacaccgacgtcatcgcgctg
ttccgcgtcactccgcaggacggcgtcgatccgatcgaagccgccgcggccgtcgccggt
gaatcgtcgaccgcgacctggacagtggtgtggaccgaccgtctgactgcggcggagaag
tatcgcgccaagtgctaccgcgtcgatccggtgccgaattcgctcggtcagtacttcgct
tacatcgcctacgacctcgatctgttcgagccgggctcgatctccaatctcaccgcgtcg
atcatcggcaacgttttcggcttcaagccgctgaaggcgctgcggctcgaggacatgcgg
ctgccgatcgcttacgtgaagacgttccagggcccggcgaccggcatcgtggtcgagcgc
gagcgcatggacaagttcggtcggccgctgctcggcgccaccgtcaagccgaagctcggc
ctgtcgggtcgtaactacggccgcgtggtgtacgaggcgctgaagggcggcctcgacttc
accaaggacgacgagaacatcaactcgcagccgttcatgcattggcgcgagcgcttccaa
tactgcatggaggcggtcaacaaggcccaggcacagaccggcgagatcaagggcacctac
ctcaacgtcaccgcggcgacgatggaggacatgtacgagcgcgccgaatacgccaaggag
ctcggctcgatcatcgtgatgatcgacctcgtgatcggctacacggcgatccagtcgatg
gccaagtgggcgcgcaagaacgatatgatcctgcatctgcaccgcgccggtcactcgacc
tacacgcggcagcgcaatcacggcgtgtcgttccgcgtcatcgccaagtggatgcggctc
gcaggcgtcgaccacatccatgccggcaccgtggtcggcaagctcgaaggcgatccggcg
accaccaagggctactacgacatctgccgcgaggacttcaacccgatgacgctggagaac
ggcctgttcttcgaccagcattgggccagcctcaacaagctgatgccggtggcctcgggc
ggcattcatgccggccagatgcatcagctgttgcacctgctcggcgaagacgttgtgctg
cagttcggcggcggcaccatcggccacccgatgggcatcgcggccggcgccaccgccaac
cgcgtcgcgctggaagcgatgatcctcgcccgcaacgagggccgcgactacctgcacgaa
ggcccggaaatcctcgccaaggcggcgcagacctgcaccccgctgaaggccgcgctcgac
acctggaagaacgtgaccttcaactacgaatccaccgacacccccgactacgcgccgacc
ccgtcggtctcggtctaa

DBGET integrated database retrieval system