KEGG   Rhodopseudomonas palustris CGA009: RPA1560Help
Entry
RPA1560           CDS       T00153                                 

Gene name
cbbS
Definition
(GenBank) ribulose-bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00630  Glyoxylate and dicarboxylate metabolism
rpa00710  Carbon fixation in photosynthetic organisms
rpa01100  Metabolic pathways
rpa01120  Microbial metabolism in diverse environments
rpa01200  Carbon metabolism
Module
rpa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rpa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rpa_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RPA1560 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RPA1560 (cbbS)
Enzymes [BR:rpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RPA1560 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small DUF772
Motif
Other DBs
NCBI-ProteinID: CAE27001
CyanoBase: RPA1560
CYORF: RPA1560
UniProt: Q6N9I9
LinkDB All DBs
Position
1733171..1733593
Genome map
AA seq 140 aa AA seqDB search
MRLTQGCFSFLPDLTDEQIAAQVQYALSKGWAVNLEFTDDPHPRNTYWDMWGLPMFDLQD
AAGVMMELNECRKIYGDRYIRLSAFDSSHGWESVRLSFIVNRPKDEPGFRLDRQESDGRN
MRYTTRAYSADKPEGRRYGG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgacccaaggctgtttctcgttcctgcccgatctcaccgacgagcagatcgcc
gctcaggtgcaatacgcgctgtccaagggctgggcggtgaacctggaattcaccgacgat
ccgcatccccgcaacacttattgggacatgtggggcctgccgatgttcgatctgcaggac
gccgccggcgtgatgatggaactgaatgaatgccgtaagatctacggcgatcgttacatc
cggctgtcggcgttcgactcctcgcacggctgggagtctgtgcggctgtcgttcatcgtc
aaccgcccgaaggacgagcccggcttccggctcgaccggcaggagtccgacggccgcaac
atgcggtacaccacacgcgcctattcggccgacaagcctgaaggccgacgctacggaggc
tga

DBGET integrated database retrieval system