KEGG   Rhodopseudomonas palustris CGA009: RPA1772Help
Entry
RPA1772           CDS       T00153                                 

Gene name
ppc
Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00620  Pyruvate metabolism
rpa00680  Methane metabolism
rpa00710  Carbon fixation in photosynthetic organisms
rpa01100  Metabolic pathways
rpa01120  Microbial metabolism in diverse environments
rpa01200  Carbon metabolism
Module
rpa_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPA1772 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RPA1772 (ppc)
   00680 Methane metabolism
    RPA1772 (ppc)
Enzymes [BR:rpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RPA1772 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CAE27213
CyanoBase: RPA1772
CYORF: RPA1772
UniProt: O32483
LinkDB All DBs
Position
1984721..1987531
Genome map
AA seq 936 aa AA seqDB search
MSSLNLSAGPEPVSERPDDAAAIEAETRLRNDIRLLGRILGDTVREQEGQSVFDLVENIR
QTSIRFHRDDDKTARAELAAILDGMSIQDTMRIVRAFSYFSHLANIAEDQNNIRQMRAGS
TAGSAPRAGLLAKTLAHARQEGISAAELRKFFATALVSPVLTAHPTEVRRKSTMDREMQI
AGLLDQRDRVQLTADEWTDNEERLRRAVETLWKTNLLRRTKLTVLDEVTNGLSFYDYTFL
REVPRLHSALEDRLADAAKAEGANAEGELASFLRMGSWIGGDRDGNPFVTAEVLHGTLKL
QSTRVLRYYLEELHELGSELSLASHLAGTTDTVKALAETSPDTSPHRKYEPYRLAVSGIY
ARLAATALKLEVENLRAPVGEAEPYASAQDFKADLDAIHLSLTTHHSGVIARGRLRQLRR
AIDCFGFHLASLDMRQNSAVHERTIGELMDAARPGTSYAVLDEDARIALLISELRSTRPL
TSMFVKYSDETVGELAVFREAAKAHATYGAAAIPQCIISMTKGVSDLLELAVLLKEVGLI
DPSGRSAINVVPLFETIEDLQACAKIMDRLLSIPEYRRLVDSRGSVQEVMLGYSDSNKDG
GFVTSGWELYKAEIGLIEIFEHHGVRLRLFHGRGGSVGRGGGPSYDAIVAQPGGAVNGQI
RITEQGEIITSKYSNVEVGRNNLEILAAATLEASLLQPKRVAPHRDYLEAMEQLSALAFK
AYRGLVYETDGFVDYFWASTVINEISTLNIGSRPASRKKTRAIEDLRAIPWVFSWAQCRL
MLPGWYGFGSAVSAWVTEHPEKGIAFLQAMYQEWPFFRTLLSNMDMVLSKSSIGIASRYA
ELVEDTAIRDRIFSRIRAEWHSSIDYLLAIMQQDHLLQSNPLLERSIRHRFPYLDPLNHV
QVQLLREHRTHDPDEQVLRGVQLTINGISAGLRNSG
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgctgaatctgtccgccggccccgagccggtctccgaacgtcctgacgacgcg
gccgcgatcgaagccgagacccggctgcgcaacgacatccggctgctcggccgcattctc
ggcgataccgtgcgcgagcaggaaggccagagcgtgttcgatctggtcgagaacatccgc
cagacctcgatccgcttccatcgcgatgacgacaagaccgcgcgcgctgaactcgccgcc
attctcgacggcatgtcgatccaggacacgatgcggatcgttcgcgccttcagctatttc
tcgcacctcgcaaacatcgccgaggaccagaacaacatccgccagatgcgcgccggctcg
accgccggttcggcgccgcgcgccggcctgctcgccaagacgctggcgcacgcgcggcag
gagggcatcagcgccgcggagctgcgcaagttctttgcgaccgcgctagtcagcccggtg
ctgaccgcgcatccgaccgaggtgcgccgcaagagtacgatggaccgggagatgcagatc
gcaggattgctcgatcagcgcgaccgcgttcagctcaccgctgacgaatggaccgacaac
gaggagcggctgcgccgcgccgtcgagacgctatggaagaccaacctgctgcgccggacc
aagctgacggtgctggacgaagtcaccaacgggctgtcgttctacgactacaccttcctg
cgcgaagtgccacggctgcacagcgcgctggaggaccggctcgccgatgcggcgaaagcc
gaaggcgccaacgccgagggcgagctcgccagcttcctgcggatgggaagctggatcggc
ggtgaccgcgatggcaatccgttcgtcaccgccgaggtgctgcacggcaccttgaagcta
cagagcacgcgggtgctgcgctattatctcgaggagctgcacgagctcggctcggaattg
tcactggcctcgcatctcgccggcaccaccgacaccgtcaaggcgctggccgaaacttcg
cccgacacctcgccgcatcgcaaatacgagccgtatcgcctcgcggtgtccggcatctat
gcgcggctcgccgccacggcgctcaagctcgaggtcgagaacctccgcgccccggtcggc
gaggccgagccctatgccagcgcgcaggacttcaaggccgatctcgatgccatccatctt
tccctgaccacgcatcattccggcgtgatcgcacgcggtcggctgcgccagctccgtcgt
gcgatcgactgcttcggcttccatctcgccagcctcgacatgcggcagaactcggcggtg
catgagcgcaccatcggcgagctgatggatgcggcccggcccggcacgtcctacgcggtg
ctggatgaggatgcacggatcgctctgctgatcagcgagttgcgtagtacccggccgctg
acctcgatgttcgtcaaatacagcgacgagacggtcggcgagcttgcggtgttccgcgaa
gccgccaaggcgcacgcgacctacggggcggcggcgatcccccaatgcattatctcgatg
acaaagggcgtctccgacctcttggaactcgcggtgctgctcaaggaagtcgggctgatc
gatccatccgggcgcagcgccatcaacgtggtgccgctgttcgagaccatcgaggatctg
caggcctgcgccaagatcatggaccggctgctgtcgatccccgaatatcgccgcctggtc
gacagccgcggctcggtgcaggaggtgatgctcggctactccgacagcaataaggacggc
ggcttcgtcacctcaggctgggagctgtacaaggccgagatcggcctgatcgagatcttc
gagcaccacggtgtgcggctgcggctgttccacggccgtggcggctcggtcggccgcggc
ggcggcccgagctacgatgcgatcgtggcgcagccgggtggtgcggtgaacggccagatc
cgcatcaccgagcagggcgagatcatcaccagtaaatattccaacgtcgaagtcggccgc
aacaatctcgagatcctcgccgccgcgacgctggaggccagcctgctgcagccgaagcgg
gtggcaccgcatcgcgactatctcgaagcgatggagcagctctcggccttggccttcaag
gcctaccgcggcctggtgtacgagaccgacggcttcgtcgattacttctgggcctcgacg
gtgatcaatgagatctcgacgctgaacatcggtagccgcccggcctcgcgcaagaagacc
cgcgcgatcgaagacctccgcgccatcccctgggtgttctcatgggcgcagtgccggctg
atgctgccgggctggtacggcttcggcagcgcggtctcggcctgggtcaccgaacacccg
gagaagggcatcgcgtttcttcaggcgatgtatcaggagtggccgttcttccgtacgctg
ttgtcgaatatggacatggtgctgtcgaagagctcgatcggtatcgcctcgcgctatgcc
gagctggtcgaagacaccgcgatccgcgaccgcatcttcagccgcatccgcgccgaatgg
cattcgtcgatcgactatctcctggcgatcatgcagcaggaccatttgctgcagagcaac
ccattgctcgaacgctcgatccgccaccgcttcccgtatctcgatccgctgaaccacgtc
caggtccagctgctgcgcgaacatcgtacccacgatccggacgaacaggtgctgcgcggc
gtgcaactgacgatcaacgggatttccgcggggctgcggaatagcgggtga

DBGET integrated database retrieval system