KEGG   Rhodopseudomonas palustris CGA009: RPA2323Help
Entry
RPA2323           CDS       T00153                                 

Gene name
goaT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00250  Alanine, aspartate and glutamate metabolism
rpa00280  Valine, leucine and isoleucine degradation
rpa00410  beta-Alanine metabolism
rpa00640  Propanoate metabolism
rpa00650  Butanoate metabolism
rpa01100  Metabolic pathways
rpa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPA2323 (goaT)
   00650 Butanoate metabolism
    RPA2323 (goaT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RPA2323 (goaT)
   00280 Valine, leucine and isoleucine degradation
    RPA2323 (goaT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPA2323 (goaT)
Enzymes [BR:rpa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RPA2323 (goaT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     RPA2323 (goaT)
Amino acid related enzymes [BR:rpa01007]
 Aminotransferase (transaminase)
  Class III
   RPA2323 (goaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CAE27764
CyanoBase: RPA2323
CYORF: RPA2323
UniProt: Q6N7D5
LinkDB All DBs
Position
2631514..2632788
Genome map
AA seq 424 aa AA seqDB search
MTNSELLTRRQTAVVRGVSQATPVFAERALNSEIWDVEGKRYVDFAGGIAVLNTGHCHPR
IVAAIREQLDRFTHTCFQVAPYEGYIRLAERLNQLAPINGPLKSILLSTGAEATENAVKI
ARAATGRSGVIAFTGGFHGRTAFASAMTGKVIPYKKALGPPLPGVWHVPFPVAGSDVSVE
DALRCVQFVFKADIDASQVAAIIIEPVQGEGGFHQAPPELMRGLRRLCDENGIVLIADEV
QTGFGRTGKMFAMEHYDVQADIVCVAKSLAGGLPLSGVIGRAAIMDAAEPGGLGGTYAGN
PLACAAALAVLDVFEEENLIARANQIGERLRSAIDRFALSNTLVPTSVARGPGAMVAFDI
LKQRGSNEPDAEATKRVTRLAHENGLILLSCGTAANTIRILVPLTASDAIVDEGLAILER
CLAA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatagtgaattgctgacgcgcaggcagacggctgtcgtgcggggcgtcagccaa
gcgacgccggtgtttgcagaacgtgcgctgaatagcgagatctgggacgtcgagggcaag
cgttacgtcgatttcgccggcggcatcgccgtgctcaacaccggtcattgccatccgcgc
atcgtcgcggcgatccgtgagcagctcgatcgcttcacccacacctgtttccaggtcgcg
ccttatgaaggttacatccggctcgccgagcgcctgaatcagttagcgccgatcaatggg
ccgctgaagtcgatcctgctcagcaccggtgcggaagccaccgagaacgctgtcaagatt
gcgcgcgccgcgaccggccgcagcggtgtgatcgccttcacgggtggtttccatggccgc
accgcattcgcctcggcgatgaccggcaaggtcattccttacaagaaggcgcttggtccg
ccgcttcctggtgtctggcatgttccgttccctgtcgccggtagtgacgtctcggtcgag
gatgcgctgcgctgcgtgcagttcgtgttcaaggccgatatcgatgcgtcgcaggttgcc
gcgatcatcatcgagccggtgcagggcgagggcggcttccatcaagcgccgcccgaactg
atgcggggcttgcgcaggctgtgcgacgagaacggcatcgtactgatcgccgacgaagtg
cagaccggcttcgggcgcaccggcaagatgttcgcgatggaacactatgacgttcaggcc
gacatcgtctgcgtcgccaagagccttgccggcggcttgccgctgtcgggcgtgatcggc
cgcgccgcgatcatggatgcggcggagccgggcggcctcggcggcacctatgcgggcaat
ccgctggcctgcgccgcagcgctcgcggtgctcgacgtgttcgaagaagagaatttgatc
gcgcgtgcgaaccagatcggcgagcggctgcgcagcgcgatcgatcggttcgcgctgtcg
aacacgctggtgccgacctcggtcgcgcgcggccctggtgcgatggttgcgttcgatatc
ctcaagcagcgcggcagtaacgagccggatgcggaggcgaccaagcgggtgacccggctg
gcgcacgaaaacggcttgatcctgctgtcgtgcggcaccgccgccaacaccattcgcatt
ctggtgccgctgacggcgtccgatgcgatcgtcgacgaggggttggcgatcctggagcgc
tgcctcgccgcttag

DBGET integrated database retrieval system