KEGG   Rhodopseudomonas palustris CGA009: RPA3252Help
Entry
RPA3252           CDS       T00153                                 

Gene name
tufA, EF-Tu
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rpa  Rhodopseudomonas palustris CGA009
Brite
KEGG Orthology (KO) [BR:rpa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rpa03012]
    RPA3252 (tufA)
   03029 Mitochondrial biogenesis [BR:rpa03029]
    RPA3252 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpa04147]
    RPA3252 (tufA)
Translation factors [BR:rpa03012]
 Eukaryotic Type
  Elongation factors
   RPA3252 (tufA)
 Prokaryotic Type
   RPA3252 (tufA)
Mitochondrial biogenesis [BR:rpa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RPA3252 (tufA)
Exosome [BR:rpa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RPA3252 (tufA)
  Exosomal proteins of breast cancer cells
   RPA3252 (tufA)
  Exosomal proteins of colorectal cancer cells
   RPA3252 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CAE28693
CyanoBase: RPA3252
CYORF: RPA3252
UniProt: Q6N4Q4
LinkDB All DBs
Position
complement(3659926..3661116)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETQNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDPELLELVEMEVRELLSKYDFPGDDIPIVKGSALAALE
NSDAKLGHDAILELMRQVDAYIPQPERPIDQPFLMPVEDVFSISGRGTVVTGRVERGILK
VGDEIEIVGIRDTQKTTCTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVAAIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcaaagtttgaacgtacgaagccgcattgcaacatcgggacgatcggtcac
gtcgaccacggcaagacgtcgctgacggcggcgatcaccaaggttctggcggagacgggc
ggtgcgacgttcacggcctatgaccagatcgacaaggcgccggaagagaaggcgcgcggc
atcacgatttcgaccgcgcacgtcgagtacgagacgcagaaccgtcactacgcgcacgtc
gactgccccggccacgccgactacgtgaagaacatgatcaccggtgcggcgcagatggac
ggcgcgatcctggtggtgtcggcggccgacggcccgatgccgcagacccgcgagcacatc
ctgctggcccgtcaggtcggcgtgccggcgctggtcgtgttcctgaacaagtgcgacatg
gtcgacgatccggaactgctcgagctggtcgagatggaagtgcgcgagcttctgtcgaag
tacgacttcccgggcgacgacattccgatcgtcaagggttcggcgctggcggcgctggag
aactcggacgccaagctcggtcacgacgcgatcctggagctgatgcgccaggtcgacgcc
tacatcccgcagccggagcgtccgatcgaccagccgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggccgtgtcgagcgcggcattctgaag
gtcggcgacgaaatcgagatcgtcggcatccgcgacacgcagaagaccacctgcaccggc
gtcgaaatgttccgcaagctgctcgatcagggccaggcgggcgacaacatcggcgcgctg
ctgcgcggcaccaagcgtgaggacgtcgagcgtggccaggtgctgtgcaagccgggttcg
gtgaagccgcacaccaagttcaaggccgaagcctacatcctgaccaaggaagagggcggc
cgccacaccccgttcttcaccaactaccgtccgcagttctacttccgcaccaccgacgtg
accggtgttgtgcacctgccggaaggcaccgagatggtgatgccgggcgacaacatcgcg
atggaagtgcacctgatcgtgccgatcgcgatggaagaaaagctgcgcttcgccatccgc
gaaggcggccgcacggtcggtgccggcgtcgtcgccgcgatcatcgagtaa

DBGET integrated database retrieval system