KEGG   Rhodopseudomonas palustris CGA009: RPA4410Help
Entry
RPA4410           CDS       T00153                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00564  Glycerophospholipid metabolism
rpa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RPA4410 (glpD)
Enzymes [BR:rpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RPA4410 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox_2 Pyr_redox FAD_binding_3 NAD_binding_8 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CAE29851
CyanoBase: RPA4410
CYORF: RPA4410
UniProt: Q6N1J5
LinkDB All DBs
Position
complement(4966312..4967847)
Genome map
AA seq 511 aa AA seqDB search
MVYDLAIIGGGINGCGIARDAAGRGHSVFLCEMNDLASGTSSWSTKLIHGGLRYLEYFEF
RLVREALIERERLWQIAPHIIGPLRFVLPHHDGLRPAWRLRLGLFMYDYLGGRKLLPPTR
SVDLAHDEVGKPLIPGRYTKGFEYSDCFVDDARLVVLTARDAAERGAEIRTRTRAVQVSQ
QGGIWQVTLEDVGSGARSTIQARALVNAAGPWVEGVLRSGAGVDARYKVRLVQGSHIVTR
KLYDHDRAYIFQNADGRIVFAIPYQGDFTLIGTTDRDYHGDPSQVKATPEEIDYLCKAVS
GYFAKPVTPADVVWTFSGVRPLYDDGASEAKAATRDYVFELDTPGGAPLLSIYGGKITTY
RRLAEEALEKLSSYLKGGTAKQGWTAHQPLPGGDFPVDGGPALIGDLLREYPFLASAHAS
RLVHAYGTRARDVLGSAKSAADLGRDFGATLTEAEVRYLMSREWACSADDIVWRRSKLGL
RLTPAAVAALDEWVIVHRAAEKPQQQAGGRA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggtgtacgacctcgcgatcatcgggggcgggatcaacggctgcggcatcgcgcgcgat
gcggcgggccggggacattccgtgttcctgtgcgagatgaacgacctcgccagcggcacc
tcgtcgtggtcgaccaagctgatccatggcgggctgcgctatctcgaatatttcgagttt
cgcctggtgcgcgaggcgctgatcgagcgcgagcggctgtggcagatcgcgccgcatatc
atcgggccactgcgtttcgtgctgccgcatcacgacggcctgcgtccggcctggcggctg
cggctcggcttgttcatgtacgattatctcggcggccggaagctgctgccgccgacccgt
tcggtcgatctggcgcatgacgaggttggcaagccgctgattcccggtcgctacaccaag
ggcttcgaatactccgattgctttgtcgatgacgcgcggctggtggtactcaccgcacgc
gacgcggccgagcgcggcgccgagatccgcacccggactcgcgcagtccaggtcagccag
cagggcggcatctggcaggtgacgctggaagatgttggtagcggcgcccgcagcacgatc
caggcgcgggcattggtcaacgccgccggcccctgggtcgaaggcgtgctccgctccggc
gccggggtcgatgcccgctacaaggtgcggctggtgcaaggctcgcacatcgtcacccgc
aagctctacgaccacgaccgcgcctacattttccagaacgccgacggccgcatcgtgttt
gcgattccctatcagggcgacttcaccctgatcggcaccaccgaccgcgactatcacggc
gatccgtcacaggtgaaagcgacgccggaggaaatcgattatctgtgcaaggcggtgagc
ggctatttcgccaagcccgtgacgccggcggatgtggtgtggaccttctcgggcgtgcgg
ccgctgtatgacgacggcgccagcgaagccaaggcggcgacccgcgactacgtgttcgag
ctcgacaccccgggcggcgcgccgctgctgtcgatctatggtggcaagatcaccacctat
cgccggcttgccgaagaggcgttggagaagctgtcctcctacctgaagggcggaacggcc
aaacagggctggaccgcgcatcagccgttgcccggcggcgatttcccggtcgacggcggt
ccggcgctgatcggcgacctgctgcgcgagtatccgttcctggcttcggctcacgcctcg
cgtctggtgcacgcctacggcacccgggcgcgtgacgtgctcggctcggccaagtcggcg
gccgatctcggccgcgacttcggcgccacattgacggaggccgaggtccgctatctgatg
agccgcgaatgggcctgcagcgcggacgacatcgtctggcggcgatccaagctcggtttg
cggctgacaccggccgcggtcgccgcgctcgacgaatgggtcatcgtccaccgcgccgcc
gagaagccccagcagcaagcgggaggccgggcatga

DBGET integrated database retrieval system