KEGG   Rhodopseudomonas palustris CGA009: RPA4568Help
Entry
RPA4568           CDS       T00153                                 

Definition
(GenBank) putative enoyl-acyl carrier protein reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00061  Fatty acid biosynthesis
rpa00780  Biotin metabolism
rpa01100  Metabolic pathways
rpa01130  Biosynthesis of antibiotics
rpa01212  Fatty acid metabolism
Module
rpa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rpa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RPA4568
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RPA4568
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    RPA4568
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rpa01004]
    RPA4568
Enzymes [BR:rpa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     RPA4568
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     RPA4568
Lipid biosynthesis proteins [BR:rpa01004]
 Fatty acid synthase
  Component type
   RPA4568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: CAE30008
CyanoBase: RPA4568
CYORF: RPA4568
UniProt: Q6N141
LinkDB All DBs
Position
complement(5148539..5149300)
Genome map
AA seq 253 aa AA seqDB search
MNLQGKKGLVVGIANDQSIAFGCARAFRDAGAELAVTYLNDKAAPHVVPLAEQLGCPIVV
PCDVREPGQLEAVFERISQQWGRLDFLLHSIAFAPKEDLHGRVVDCSQAGFAMAMDVSCH
SFIRMAKLAEPLMPDGGCLLTVSFYGSEKVVEDYNLMGPVKAALESSVRYIAAELAPKKI
RVHALSPGPLMTRAASGIARFDELLERTRARLPAHQLVSIEDVGAVAAFLVGDSARSLTG
NIEYIDAGYHVIG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgcagggtaagaagggtctggtcgtcggcattgccaacgatcagagcatcgca
ttcggttgcgcgcgcgcgtttcgcgacgccggcgccgaactcgccgtcacctatctcaac
gacaaggccgcgcctcacgtcgtcccactcgccgaacagctcggctgtccgatcgtggtg
ccgtgcgacgtgcgcgagcctggccagctcgaagccgtgttcgaacggatatcccagcaa
tggggccggctcgatttcctgctgcattcgatcgcgttcgcgccgaaggaagacctccac
ggtcgcgtcgtcgattgctcgcaggccggctttgcgatggcgatggacgtgtcgtgtcat
tcgttcatccgcatggccaagctcgccgagccgctgatgccggacggcggctgcctgctc
accgtgtcgttctacggctcggagaaggtggtcgaagactacaacctgatgggtccggtg
aaggccgcgctggaaagctcggtgcgctacatcgcggccgaactggcgccgaaaaagatc
cgcgttcatgcgctgtccccggggccactgatgacgcgcgccgcgtcgggcatcgcgcgg
ttcgacgaactcctggagcgcacccgcgcccggctgccggcacatcagcttgtgagcatc
gaagatgtcggtgcggtcgccgcctttctggtcggtgacagcgcgcggtcgctcaccggc
aatatcgaatacattgacgccggctatcatgtgatcggctga

DBGET integrated database retrieval system