KEGG   Rhodopseudomonas palustris HaA2: RPB_0536Help
Entry
RPB_0536          CDS       T00321                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01130  Biosynthesis of antibiotics
rpb01230  Biosynthesis of amino acids
Module
rpb_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPB_0536
Enzymes [BR:rpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     RPB_0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABD05247
UniProt: Q2J2R3
LinkDB All DBs
Position
601413..602561
Genome map
AA seq 382 aa AA seqDB search
MTAPLNHSAPIKVEVALGDRAYDIVIGRNVLGTLGERIAKLRPGARTAIVTDRTVARTWL
APTEAALDAAGIAHARVVVGEGESSKTYAGLAEVSEALIAAKIERNDLVIALGGGVVGDL
AGFAASILRRGVDFVQVPTSLLAQVDSSVGGKTGINSPQGKNLLGAFHQPVLVIADTAVL
DTLSPRQFRAGYAEVAKYGALGDEAFFAWLEANHAEIVSGGPAREHAIATSCRAKAAIVA
RDERENGERALLNLGHTFGHALEAATGFSDRLFHGEGVAIGMVLAARFSAERGMMPEADA
IRLQRHLADVGLPTRLQDIAGFAQEGLADADALLALMTQDKKVKRGQLTFILMEGIGRAV
IADKVEPAPVRDFLARQLARAS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgccgctgaaccattccgctccgatcaaggtcgaggtcgcgctcggcgatcgc
gcctacgacatcgtgatcggccgcaacgtgctcggcacgctcggcgagcggatcgccaag
ctgcggcccggcgcgcgcaccgcgatcgtcaccgatcgcaccgtggcgcggacctggctg
gcgccgaccgaggcggcgctggatgccgccggcatcgcgcatgcgcgcgtcgtggtcggc
gagggcgaaagctccaagacctatgcggggctggcggaagtcagcgaggcgctgatcgcc
gccaagatcgaacgcaacgatctggtgatcgcgctcggcggcggcgtggtcggcgatctc
gccggcttcgcggcgtcgatcctgcgccgcggcgtcgatttcgtgcaggtgccgacctcg
ctgctggcacaggttgattcgtcggtcggcggcaagaccggcatcaactcgccgcagggc
aagaacctgctcggcgcgttccatcagcccgtattggtgatcgccgacaccgcggtgctc
gacacgctgtcgccgcgccagttccgtgccggctatgccgaagtggcgaaatacggcgcg
ctcggcgacgaggcgttcttcgcctggctcgaagccaatcacgccgagatcgtctcaggc
gggccggcgcgcgagcacgccatcgccacgtcgtgccgggcgaaggcggcgatcgtggcg
cgcgacgagcgcgaaaacggcgagcgcgcgctgctcaatctcggccacacgttcggccat
gcgctggaggccgcgaccggcttctccgaccggctgtttcacggcgagggcgtggcgatc
ggcatggtgctggcggcgcggttctccgccgagcgcggcatgatgccggaggccgacgcc
atccggctgcagcgccatctcgccgatgtcggcctgccgacccggctgcaggacatcgcc
ggcttcgcccaggaaggcctcgccgacgccgacgcgctgttggcgctgatgactcaggac
aagaaggtcaaacgcggccagctcaccttcatcctgatggaagggatcggccgcgcggtg
atcgccgacaaggtcgagccggcgccggttcgcgatttcctggcccggcagctcgcgcgc
gcatcgtga

DBGET integrated database retrieval system