KEGG   Rhodopseudomonas palustris HaA2: RPB_1025Help
Entry
RPB_1025          CDS       T00321                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00061  Fatty acid biosynthesis
rpb00780  Biotin metabolism
rpb01100  Metabolic pathways
rpb01130  Biosynthesis of antibiotics
rpb01212  Fatty acid metabolism
Module
rpb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RPB_1025
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RPB_1025
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    RPB_1025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rpb01004]
    RPB_1025
Enzymes [BR:rpb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     RPB_1025
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     RPB_1025
Lipid biosynthesis proteins [BR:rpb01004]
 Fatty acid synthase
  Component type
   RPB_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ABD05735
UniProt: Q2J1C5
LinkDB All DBs
Position
1176374..1177135
Genome map
AA seq 253 aa AA seqDB search
MTLQGKKGLVVGIANAESIAFGCARAFRDAGAELAVTYLNDKAKPHVGPLAEQLQSPIVL
PCDVREPGQLEAVFAQIGETWGRLDFLLHSIAFAPKEDLHGRVVDCSQAGFAMAMDVSCH
SFIRMAKLAEPLMRDGGCLLTVTFYGSEKVVEDYNLMGPVKAALESSVRYMAAELAVKRI
RVHALSPGPLKTRAASGIARFDELMERTRARAPAHQLVGIDDVGQVATFLVGDGARALTG
NIEYIDAGYHVVG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcaaggtaaaaagggactggtggtcgggatcgccaatgcggagagcatcgcc
ttcggctgcgcccgggctttccgcgacgccggcgcagagctggccgtcacctatctcaac
gacaaggcgaagccgcatgtcgggccgctcgccgaacagttgcaaagcccgatcgtgctg
ccctgcgatgtccgcgagccgggccagctcgaggcggtgttcgcgcagatcggcgagacc
tggggccggctcgacttcctgctgcattcgatcgccttcgccccgaaggaggatctgcac
ggaagggtggtggattgctcgcaggccggctttgcgatggcgatggacgtgtcctgccat
tccttcatccggatggcgaagctcgccgagccgctgatgcgggacggcggctgtctgttg
acggtcacgttctacggctccgagaaggtggtcgaggactacaatctgatggggccggtg
aaggccgcgctggaaagctcggtgcgctacatggcggccgaactggcggtgaagcgcatc
cgagtccacgcgctgtcgccggggccgctgaagacccgcgccgcctccggcatcgcccgc
ttcgacgagttgatggagcgcacccgcgcccgcgccccggcgcaccagctcgtcggcatc
gacgacgtcggccaggtcgcgaccttcctggtcggcgacggcgcccgcgcgctcaccggc
aacatcgaatacatcgacgccggatatcacgtcgtcggctga

DBGET integrated database retrieval system