KEGG   Rhodopseudomonas palustris HaA2: RPB_1876Help
Entry
RPB_1876          CDS       T00321                                 

Definition
(GenBank) ATP dependent DNA ligase, central
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    RPB_1876
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rpb03400]
    RPB_1876
Enzymes [BR:rpb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RPB_1876
DNA repair and recombination proteins [BR:rpb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RPB_1876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ABD06584
UniProt: Q2IYX6
LinkDB All DBs
Position
2138794..2141538
Genome map
AA seq 914 aa AA seqDB search
MAASKTLTLYRNKRDFEQTAEPRGDAEVVPSKRRRFVIQKHDATRLHYDLRLEYDGVFKS
WAVTRGPSLDPRDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVQLWDRGYWDCDDPERG
FKTGDLKFTLDGEKVHGSWVLVRMRHDRNGGKRTNWLLIKHRDDDAREGKANDILDEDRS
VASGRTMKQIAEGKGRAPKPFMTGKVARVKADAVWDSNKGLAADARAADDAGKAARPKRA
AAKKAPKKAAAKSRTTKTTSRATRKPVKVAAMPDFIPPQLCTSVERPPGSDGWRHEIKFD
GYRMQLRIAHGEAALRTRKGLDWTAKFRAIADEAAGLPDAIIDTEIVALDHHGHPDFAAL
QAALSDGDSDKLICFAFDLLYADGEDLRSLPLSERKQRLQDLLKAARGRRKEGLIRYVEH
FETGGDAILQSACKLSLEGIVSKKLDAPYRSGRSDNWTKAKCRAGHEVVIGGWKTTAGKF
RSLMVGVQSDDRAGNHHLAYVGLVGTGFGQDVVKRILPELKARASKDNPFAGENAPRKTS
DVNWVTPDLVAEIEFAGFTGAGMVRQAAFKGLRADKPADEVVAEKPAQVGIARPKPKRGT
KAAPAVRKVASAASRAEVMGISISKPDKVLWPASEISEAITKLDLAHYYEAVGDWLIAHI
KGRPCSIVRAPDGIDGEHFFQRHAMPGMSNLIDLAKVSGDRKPYVQIDRVEGLIAVAQIG
GLELHPWNCAPGAYDVPGRLVFDLDPAPDVGFDDVVAAAREMKDRLETIGLSTFCKTTGG
KGLHVVVPLQPKDDVDWKQAKIFAQTVCAQMADDSPERYLLNMSKQQRKGKIFLDYLRND
RMSTAVAALSPRAREGATVSMPVTWSQVKAGLDPKRFTLGTVPALLRKTKAWADYDESAA
PLRAALEALASSGA
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggcggccagcaagaccctcaccctgtatcgcaacaagcgcgacttcgaacagaccgcc
gagccgcgcggcgatgccgaggtcgtgccgtcgaagcggcggcgcttcgtaattcagaag
cacgacgcgacgcggctgcactacgacctgcggctcgaatatgacggcgtgttcaagtcc
tgggcggtgacgcgcggcccatcgctcgatccacgcgacaagcggctcgcggtcgaggtc
gaggaccacccgctcgactacggcgacttcgaaggcaccattcccaagggccagtacggc
ggcggcacggtgcaactctgggaccgcggctattgggactgcgatgatcccgagcggggg
ttcaagaccggcgatctgaaattcacgctcgacggcgagaaggtgcacggcagctgggtg
ctggtgcggatgcgccacgaccgcaacggcggcaagcggaccaactggctgctgatcaag
catcgcgacgacgacgcccgcgagggcaaggccaacgacattctcgacgaggatcgctcg
gtggcgtcgggccggaccatgaagcagatcgccgaaggcaaggggcgggcgccgaagccg
ttcatgacaggcaaggtggcgcgggtgaaggccgacgcggtgtgggactcgaacaagggg
ctggccgcggacgcgcgcgcggccgacgacgccggaaaggcggcgagacccaagcgcgcc
gcggcgaagaaggcgccgaagaaggccgcagcgaagtcccgcacaacgaagacgacgtcg
agggccacgcgcaagccggtgaaggtcgccgcaatgccggacttcatcccgccgcagctc
tgcacttcggtcgagcgtccgcccggcagcgacggctggcgccacgagatcaagttcgac
ggctatcggatgcagttgcgcatcgcgcacggcgaggctgcgctcaggacccgcaagggg
ctcgactggaccgcgaaatttcgggcgatcgccgacgaggctgcgggcctgccggatgcg
atcatcgacaccgagatcgtcgcgctcgatcatcacggccatcccgacttcgcggcgttg
caggcggcgctgtcggacggcgacagcgacaagctgatctgctttgcgttcgatctgctc
tatgccgacggtgaggatctacggtctttgccgctgtccgagcgcaagcagcgcctgcaa
gatctgctcaaagccgcgcgcggacgtcgcaaggaaggcctgatccgctatgtcgagcac
ttcgagaccggcggcgatgccatcctgcaatcggcctgcaagctgtcgctcgaaggcatc
gtctccaagaagctggacgcgccgtatcgctccggccgcagcgacaactggaccaaggcg
aagtgccgtgccgggcacgaggtggtgatcggcggctggaaaacgacggccggcaaattc
cggtcgctgatggtcggcgtgcagagcgacgatcgcgcggggaatcatcatttggcttac
gtcggcctggtcggcaccggattcggccaggacgtggtgaagcgcatcctgcccgagttg
aaggcgcgcgcatcaaaggacaatccgttcgcgggcgaaaacgcgccgcgcaagaccagc
gacgtgaattgggtgacaccggacctggtcgccgagatcgaattcgccggcttcaccggc
gccggcatggtgcggcaggcggcgttcaaggggctgcgcgccgacaagccggcggacgaa
gtcgtggcggagaagcctgcccaggtcgggatcgcgcggccgaagccgaagcgcgggacg
aaagcagccccggctgtgcggaaagtcgcgtccgccgccagccgcgccgaggtgatggga
atctcgatctccaagccggacaaggtgctgtggccggcgagcgagatcagcgaggcgatc
accaagctcgacctcgcacattactacgaagcggtcggcgactggctgatcgcgcacatc
aaagggcggccgtgctcgatcgtgcgggcgcccgacggcatcgacggcgagcatttcttc
cagcgccatgcgatgcccgggatgtcgaacctgatcgacctcgcgaaggtctccggtgac
cgcaagccctatgtccagatcgatcgtgtcgaagggctgatcgcggtggcgcagatcggc
ggcctcgaactgcatccgtggaactgcgcgcccggcgcctacgacgtaccagggcggctc
gtgttcgatctcgatcccgccccggatgtcggcttcgacgacgtggtcgccgcggcacgc
gaaatgaaagaccgactggagacgatcggactgtcgacgttctgcaagaccaccggcggt
aagggactgcacgtcgtggtgccgctgcagccgaaggacgacgtcgactggaagcaggcc
aagatattcgcgcagacggtgtgcgcgcagatggccgacgacagtcctgagcgttatctg
ctcaacatgtcgaagcagcagcgcaagggaaagatcttcctcgactacctgcgcaacgac
cggatgtcgacggcggtcgcggcgctgtccccccgggcgcgcgagggagccactgtatcg
atgccggtgacctggagtcaggtcaaagcgggcctcgatccgaagcggttcacgctgggt
acggtgccggccctgcttcgcaagaccaaggcgtgggcggactacgacgaatcagcggcc
ccgctgagggcggcgctcgaggcgctcgcatccagcggggcttga

DBGET integrated database retrieval system