KEGG   Rhodopseudomonas palustris HaA2: RPB_2001Help
Entry
RPB_2001          CDS       T00321                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00473  D-Alanine metabolism
rpb00550  Peptidoglycan biosynthesis
rpb01100  Metabolic pathways
rpb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RPB_2001
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RPB_2001
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    RPB_2001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rpb01011]
    RPB_2001
Enzymes [BR:rpb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RPB_2001
Peptidoglycan biosynthesis and degradation proteins [BR:rpb01011]
 Precursor biosynthesis
  Amino acid ligase
   RPB_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ABD06709
UniProt: Q2IYK1
LinkDB All DBs
Position
2273447..2274436
Genome map
AA seq 329 aa AA seqDB search
MRQTILFGGTSKERLVSVASAQALHAALPDAELWFWNDDDSVHAVTAEALLAHARPFEEA
FRPAGENIGPLERALDRAAIEQRLLVLGLHGGVAENGELQAMCEMRGVPFTGSGAAASHL
AFDKVAAKRFAAIAGVRAPAGIALAEAEAALAAHGRLIAKPARDGSSYGLFFINAKQDLV
AVRDAARSEDYLIEPFVSGIEATCGVLEQADGSLLALPPIEIVPADGGFDYTAKYLAKST
QEICPGRFAPQISARIMEDAVKAHRVMGCRGYSRSDFIVVADGPIFLETNTLPGLTKASL
YPKALQAQGIAFVDFLHGQIALAERGARR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcgacagacaattctcttcggcggcaccagcaaggagcgcctggtttcggtcgcctcg
gcgcaggcgctgcacgccgcgctgcccgatgccgaattgtggttctggaacgacgacgac
agcgtccacgcggtgaccgcggaggcgctgctggcgcatgcgcggccgttcgaggaggcg
tttcggccggctggcgaaaacatcggtccgctggagcgcgcgctcgatcgcgcggcgatc
gaacagcggctgctggtgctgggtctgcacggcggtgtcgccgagaacggcgagttgcag
gcgatgtgcgagatgcgcggcgtgccgttcaccgggtcgggcgcggcggcgtcgcatctc
gccttcgacaaggtggccgccaagcggttcgccgcgatcgccggcgtgcgcgcgccggcc
ggcatcgcgctggcggaggccgaggcggcgctggccgcccacggccggctgatcgccaag
ccggcccgcgacgggtcgagctacggcctgttcttcatcaatgcgaagcaggacctggtc
gcggtgcgcgacgcggcgaggtccgaggactatctgatcgagccgttcgtctccggcatc
gaagcgacctgcggcgtgctggagcaggccgacggctcgctgctggcgctgccgccgatc
gagatcgtgccggccgacggcggcttcgactacaccgcgaaatatctcgccaaatcgacc
caggagatctgccccggccggttcgcgccgcagatctcggcgaggatcatggaggatgcc
gtgaaggcgcatcgggtgatgggctgccgcggctattcgcgctccgacttcatcgtcgtc
gccgacggtccgatctttctcgagaccaatacgctgcccggactgaccaaggcctcgctc
tatcccaaggcgctgcaggcgcaggggatcgccttcgtcgatttcctccacggccagatc
gcgctcgccgaacgcggcgcccggcgttaa

DBGET integrated database retrieval system