KEGG   Rhodopseudomonas palustris HaA2: RPB_2266Help
Entry
RPB_2266          CDS       T00321                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rpb  Rhodopseudomonas palustris HaA2
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rpb03012]
    RPB_2266
   03029 Mitochondrial biogenesis [BR:rpb03029]
    RPB_2266
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpb04147]
    RPB_2266
Translation factors [BR:rpb03012]
 Eukaryotic Type
  Elongation factors
   RPB_2266
 Prokaryotic Type
   RPB_2266
Mitochondrial biogenesis [BR:rpb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RPB_2266
Exosome [BR:rpb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RPB_2266
  Exosomal proteins of breast cancer cells
   RPB_2266
  Exosomal proteins of colorectal cancer cells
   RPB_2266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ABD06971
UniProt: Q2IXR2
LinkDB All DBs
Position
2614825..2616015
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETTNRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDPELLELVEMEVRELLSKYDFPGDDIPIIKGSALAALE
NSDQKLGHDAILELMKAVDAYIPQPERPIDQPFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIRDTQKTTCTGVEMFRKLLDQGQAGDNIGCLLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcaaaattcgaacgtaccaagccgcattgcaatatcgggacgatcggtcac
gtcgaccatggcaagacgtcgctgacggcggcgatcaccaaggttctggcggagacgggc
ggcgcgacgttcacggcctacgaccagatcgacaaggcgccggaagagaaggcgcgcggc
atcacgatttcgacggctcacgtcgaatacgagacgacgaaccgccactacgcgcatgtc
gactgcccgggccacgccgactacgtgaagaacatgatcaccggtgcggcgcagatggac
ggcggcattctggtggtgtcggcggccgacggcccgatgccgcagacccgcgagcacatc
ctgctggcgcgccaggtcggcgtgcccgctctcgtcgtgttcctgaacaagtgcgacatg
gtcgacgatccggaactgctcgaactggtcgagatggaagtgcgcgagcttctgtcgaag
tacgacttcccgggcgacgacattccgatcatcaagggctcggcgctggccgctctggag
aactcggatcagaagctcggccacgacgcgatcctggaactgatgaaggcggtcgacgcc
tacattccgcagccggagcgcccgatcgaccagccgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggcacggtggtgaccggtcgcgtcgagcgcggcatcgtcaag
gtcggtgaggaaatcgagatcgtcggcatccgcgacacccagaagacgacctgcaccggc
gtcgaaatgttccgcaagctgctcgaccagggccaggccggcgacaacatcggctgcctg
ctgcgcggcaccaagcgcgaggacgtcgagcgcggccaggtgctgtgcaagccgggttcg
gtgaagccgcacaccaagttcaaggccgaggcctacattctgaccaaggaagagggcggc
cgtcacaccccgttcttcaccaactatcgtccgcagttctacttccgcaccaccgacgtc
accggcgtcgtgcatctgccggaaggcaccgaaatggtgatgccgggcgacaacatcgcc
atggaagtgcacctgatcgtgccgatcgcgatggaagaaaagctgcgcttcgccatccgc
gaaggcggccgcaccgtcggcgccggcgtggtggcctcgatcatcgagtaa

DBGET integrated database retrieval system