KEGG   Rhodopseudomonas palustris HaA2: RPB_2438Help
Entry
RPB_2438          CDS       T00321                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00970  Aminoacyl-tRNA biosynthesis
rpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RPB_2438
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rpb03029]
    RPB_2438
Enzymes [BR:rpb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RPB_2438
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RPB_2438
Mitochondrial biogenesis [BR:rpb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RPB_2438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABD07143
UniProt: Q2IXB7
LinkDB All DBs
Position
2793329..2794807
Genome map
AA seq 492 aa AA seqDB search
MTDLTSLTLAEARDGLVNKSFTAVELTDAHLAAIEAARVLNAYVLETPDQARQMAQAADA
QIAKGEGGPLAGIPLGIKDLFATKGTRTTACSKILGDFKPPYESTVTSQLWRDGAVLLGK
LNNDEFAMGSSNETSCFGPVVNPWRRAGSETKLVPGGSSGGSAAAVAAGLCLGATATDTG
GSIRQPAAFTGTVGIKPTYGRCSRWGIVAFASSLDQAGPIARTVRDSAILLGSMAGFDPK
DTTSVDRPVPNYEAAIGGSVKGMKIGIPKEYRLDGMPAEIEKLWMQGAEWLKAAGAELVE
VSLPHTKYALPAYYIVAPAEASSNLARYDGVRYGTRVNGRNIVEMYENTRAAGFGAEVKR
RIMIGTYVLSAGYYDAYYLRAQKVRTLIKRDFEQCFDQGVSAILTPATPSAAFGIGEKGG
ADPVEMYLNDIFTVTVNMAGLPGIAVPAGSDSQGLPLGLQLIGRPFDEETLFSLGDVIEQ
SAGRFTPAKWWA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctgacttcgctgacgctggccgaggcccgcgatggcctcgtgaacaagtcc
ttcaccgcggtcgaactgaccgacgcgcatctcgccgcaatcgaagccgcgcgtgtgctc
aacgcctatgtgctggagacgccggatcaggcacggcagatggcgcaggcggcggatgcg
cagatcgccaaaggcgagggcgggccgctcgccggcatcccgctcggcatcaaggatctg
ttcgccaccaaaggcacgcgcaccaccgcctgctcgaaaattctcggagacttcaagcct
ccctacgagtcgaccgtgacgtcgcagctgtggcgcgacggcgccgtgctgctcggcaag
ctcaacaacgacgaattcgcgatgggctcgtcgaacgagacatcgtgcttcggcccggtg
gtcaacccatggcggcgcgcgggctcggagaccaagctggttcctggcggctcgtccggc
ggctcggcggcggcggtggccgccggcctctgcctcggcgccaccgccaccgacaccggc
gggtcgatccggcagccggcggcgttcaccggcaccgtcggcatcaagccgacctatggc
cgctgctcgcgctggggcatcgtcgcgtttgcgtcctcgctcgaccaggccggtccgatt
gcccgcacggtgcgcgacagcgcgatcctgctcggctcgatggccggctttgacccgaag
gacacaacctcggtggatcgcccagtgccgaactacgaagccgcgatcggcggctcggtg
aagggcatgaagatcggcatcccgaaggagtatcggctcgacggcatgccggccgagatc
gagaaattgtggatgcagggcgccgagtggctgaaagcggcgggcgccgaattggtcgag
gtgtcgctgccgcacaccaaatacgcactgccggcctattacatcgtggcgccggcggaa
gcctcgtcgaacctcgcgcgctacgacggcgtgcgctacggcacccgcgtcaacggccgc
aacatcgtcgagatgtacgagaacacccgcgcggccggtttcggcgccgaggtcaagcgt
cgcatcatgatcggaacctatgtgctgtcggcgggctattacgacgcctattatctccgc
gcccagaaggtccgcaccctgatcaagcgcgatttcgagcagtgcttcgaccagggcgtc
tccgcgatcctgacgcccgcgacgccatcggcggcgttcggaatcggcgaaaaaggcggc
gccgatccggtcgagatgtacctgaacgacatcttcaccgtgacggtgaacatggcgggc
ctgccgggcatcgcggttccggcggggagcgactcgcagggacttccgctggggctgcaa
ctgatcgggcggccgttcgacgaggagacgttgttctccctcggcgacgtcatcgagcag
tccgccggccggttcacgccggctaagtggtgggcgtag

DBGET integrated database retrieval system