KEGG   Rhodopseudomonas palustris HaA2: RPB_3738Help
Entry
RPB_3738          CDS       T00321                                 

Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00260  Glycine, serine and threonine metabolism
rpb00630  Glyoxylate and dicarboxylate metabolism
rpb00670  One carbon pool by folate
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01130  Biosynthesis of antibiotics
rpb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RPB_3738
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPB_3738
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    RPB_3738
Enzymes [BR:rpb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     RPB_3738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: ABD08432
UniProt: Q2ITM8
LinkDB All DBs
Position
4276708..4277856
Genome map
AA seq 382 aa AA seqDB search
MLARDDSPALKRTPLHALHLARGGKMVPFAGYDMPVQYAPGVLKEHLHTRASAGLFDVSH
MGQIELRARSGRLDDAAQALETLVPQDIVALARGRQRYAQFTNDSGGILDDLMVTNLGDR
LFLVVNAACKTEDEAHLRAHMSATCEITALPGRALLALQGPKAEAALAKFCADVVALKFM
DVAELTLMDLPCVVSRSGYTGEDGFEISVPADGAEAFAQALLDRPGVQPIGLGARDSLRL
EAGLCLYGHDIDPTTTPVEAGLSWSIQKSRRSGGARPGGFLGADAILAQLDAGATRKRVG
LRPEGRAPVREGAPLYAGADTTDAIGSVTSGGFGPSLNAPVAMGYLPASQAAIDSLVFAE
VRGQRLPLRVAAMPFVTNTYKR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgctggcccgtgatgattcgcctgccctgaaacgaaccccgctgcacgcgctgcatctg
gcgcgcggtggaaaaatggtgccgttcgcgggctacgacatgccggtgcaatacgcgccg
ggcgtgctgaaggaacatctccacacccgcgcgagcgccggcctgttcgacgtgtcgcat
atgggccagatcgagttgcgcgccagatccggcaggctcgacgacgccgcgcaggcgctg
gaaacgctcgtgccgcaggacatcgtcgcgctggcgcgaggccgccagcgctacgcacag
ttcaccaacgactccggcggcatcctcgacgatctgatggtcacaaatctcggcgaccgg
ctgttcctggtggtcaacgccgcctgcaagaccgaggacgaggcgcatctgcgcgcgcat
atgagcgcgacctgcgagatcacggccctgcccgggcgcgcgctgctggcgctgcaggga
ccgaaggccgaagccgcactggcgaaattctgtgcagacgtcgtcgcactgaaattcatg
gacgtcgccgaactgacgctgatggacctgccctgcgtcgtctcgcgctccggctacacc
ggcgaggacggcttcgagatttcggtgccggccgacggcgccgaggcgttcgcgcaggcg
ctgctcgaccgccccggcgtgcagccgatcgggctcggcgctcgcgacagcctgcggctg
gaggccgggctttgcctctacggccacgacatcgaccccaccacgacgccggtcgaggcc
ggattgagctggtcgattcagaagagccgccggtccggcggcgcgcggccgggcgggttc
ctcggcgcggacgcgatcctggcgcagctcgacgccggcgccacgcgcaagcgcgtcggc
ttgcggccggaaggccgcgccccggtgcgcgagggcgcgccgctttatgccggtgcggac
acaaccgatgcgatcggctcggtgacgtcgggcggcttcggcccgagcctgaatgcgccg
gtggcgatgggctatctgcccgcctcccaggccgccatcgacagcctggttttcgccgaa
gtgcgcggccagcggctgccgctgcgcgtcgcggccatgcctttcgtaaccaacacctac
aagcgctga

DBGET integrated database retrieval system