KEGG   Rhodopseudomonas palustris HaA2: RPB_4217Help
Entry
RPB_4217          CDS       T00321                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00564  Glycerophospholipid metabolism
rpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RPB_4217
Enzymes [BR:rpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RPB_4217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox Pyr_redox_2 FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABD08908
UniProt: Q2ISA2
LinkDB All DBs
Position
complement(4789888..4791429)
Genome map
AA seq 513 aa AA seqDB search
MDRVFDLAIIGGGINGCGIARDAAGRGNSVFLCEMNDLASGTSSWSTKLIHGGLRYLEYF
EFRLVREALIERERLWQIAPHIIGPLRFVLPHHSGLRPAWRLRLGLFLYDYIGGRRLLPP
TRSVDLAHDEVGKPLIPGRFTRGFEYSDCFVDDARLVVLTARDAAERGAEIRTRTRAAQV
RQSGGIWEVTLEDTQSGVRNTIRARALVNAAGPWVEAVLASGAGVNAASKVRLVQGSHIV
VPKLYDHDRAYIFQNADGRIVFAIPYQGDFTLIGTTDRDYDGDPSQVKATPDEISYLCDA
VSAYFAGPVKPADVVWTFSGVRPLYDDGASEAKAATRDYVFELDTPGGAPLLSIYGGKIT
TYRRLSEEALEKLAPYLKGKTAKEGWTAHQPLPGGDFPVDGAPALITELTRDYPFLSAAH
AHRLVHAYGTRARDLLGAARSMADLGCDFGATLTEAEVRYLINREWACSADDIVWRRSKL
GLRLPPSALAAIDQWIAAFRASEKPQQHAGGRA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtggacagggttttcgatctcgcaattatcggcggcgggatcaacggctgtggcatcgcg
cgcgacgcggccggccgtggcaactccgttttcctgtgcgagatgaacgatctggccagc
ggcacctcgtcctggtcgaccaagctgatccatggcggtctgcgctatctcgaatatttc
gagtttcgcctggtccgcgaggcgctgatcgagcgcgagcggctgtggcagatcgcgccg
cacatcatcggtccgctgcgtttcgtgttgccgcatcattccgggttgcggccggcctgg
cggctgcggctcggcctgtttctctacgactatatcggcgggcgtcgactgctgccgccg
acgcgctccgtcgatctcgcccatgacgaggtcggcaagccgctgatccccgggcgcttc
acccgtggtttcgaatactccgattgcttcgtcgacgacgcgcgcctcgtcgtgctcacc
gcgcgcgacgccgccgagcgcggcgccgagatccgcacccgcacccgcgcggcgcaggtt
cggcagagcggcggcatctgggaggtgacgctcgaagacacgcagagcggcgtgcgcaac
acgatccgggcgcgcgcgctggtcaatgcagcgggcccatgggtcgaggcggtgctggct
tcgggcgccggcgtcaacgccgcctccaaggtgcggctggtgcaaggctcgcacatcgtg
gtgccgaagctgtacgatcacgaccgtgcctatatctttcagaatgccgacggccgcatc
gtgttcgcgattccctatcagggcgacttcaccctgatcggcaccaccgaccgcgactat
gacggcgatccctcgcaggtgaaggcgacgccggacgagatcagctatctgtgcgacgcc
gtcagcgcgtatttcgccgggccggtgaagccggctgacgtcgtctggacgttctccggc
gtgcgcccgctgtacgacgacggcgccagcgaggccaaggccgcgacccgcgactacgtg
ttcgaattggatacgccgggcggcgcaccgctgctgtcgatctacggcggcaagatcacc
acctatcgccgactgtccgaagaggcgctggagaagctcgcgccctatctgaagggcaag
accgccaaggagggctggaccgcgcaccagccgttgccgggcggcgactttccggtcgac
ggcgcacccgcgctgatcactgaactgacccgcgactatccgttcctttccgcagcgcac
gcgcaccgcctggtgcacgcctacggcacccgcgcgcgcgatctgctcggtgcggcgcgg
tcgatggccgacctcggctgcgacttcggtgccacattgacggaggcggaggtccgctat
ctgatcaaccgcgaatgggcttgcagcgcggacgacatcgtctggcggcgatccaagctc
ggcctgcggctgccgccgtccgcgctcgccgccatcgaccaatggatcgccgcgttccgc
gcgtccgaaaagccgcagcagcacgcgggaggccgggcatga

DBGET integrated database retrieval system