KEGG   Rhodopseudomonas palustris HaA2: RPB_4603Help
Entry
RPB_4603          CDS       T00321                                 

Definition
(GenBank) Glutathione S-transferase-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00480  Glutathione metabolism
rpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RPB_4603
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpb02000]
    RPB_4603
Enzymes [BR:rpb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RPB_4603
Transporters [BR:rpb02000]
 Other Transporters
  Pores ion channels [TC:1]
   RPB_4603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_N_2 GST_N GST_N_3 GST_C_2 2Fe-2S_Ferredox GST_C_6
Motif
Other DBs
NCBI-ProteinID: ABD09286
UniProt: Q2IR74
LinkDB All DBs
Position
5196701..5197315
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLSPHIALSESGLPFELVKVDLRAKKLENGDDYTQINPKGSVPALGLDDG
SVLTEGPAIVQMIADKIGGGKLAPENGTPERYRLQEWLNFISTDLHKSFGPLFSPVLGDD
AKQFFKDRIAKYFAYADKQLAGKDYLMGSSFTVADGYLFVILSWAERMKIDTSAFPNLVA
FKARVGARPQVQAALQSEGLMQKA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtattattcgcccggcgcgtgttcgctctcgccgcacatcgcactcagcgaa
tccggcctgccgttcgagctggtcaaggtcgacctccgggcgaagaagctggaaaacggc
gacgactatacgcagatcaatccgaaaggctcagtcccggcgctgggcctggacgacggc
agcgtgctgaccgaaggcccggcgatcgtgcagatgatcgccgacaagatcggcggcggc
aagctcgcacccgagaatggcacgcccgagcgctaccgcctgcaggaatggctgaacttc
atctccaccgacctgcacaagagcttcggcccgctgttctccccggtgctcggcgacgac
gccaagcagttcttcaaggaccgcatcgccaaatatttcgcctatgccgacaaacagctc
gccggcaaggactacctgatgggctcgtcgttcacggtggcggacggctatctgttcgtg
atcctgagctgggccgagcggatgaagatcgacacttcggcgtttccgaacctcgtcgcc
ttcaaggcccgcgtcggcgcccgcccgcaagtgcaggccgcgctgcagagcgaagggctg
atgcagaaggcgtga

DBGET integrated database retrieval system