KEGG   Rhodopseudomonas palustris BisB18: RPC_0734Help
Entry
RPC_0734          CDS       T00336                                 

Definition
(GenBank) glutathione S-transferase-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RPC_0734
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpc02000]
    RPC_0734
Enzymes [BR:rpc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RPC_0734
Transporters [BR:rpc02000]
 Other Transporters
  Pores ion channels [TC:1]
   RPC_0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_2 GST_N_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ABD86305
UniProt: Q21BD1
LinkDB All DBs
Position
803772..804386
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLSPHIALLEAGLPYDLVKVDIRAKKLESGEDFLSINPKGQVPALMLDSG
EVVTEGPVIVQVIADLAAAKHLAPAAGSPERYKLLEWLNFITAELHKGFSPLFQPSIPDE
VKAFFKERLMGKFKYLDGALAGHDYLMGDQFTVADGYLFTVLRWAEAMKLDLSALTTLTA
YKARVAARPMVQQALSKEGLMKAA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgtattattcgcccggcgcctgctcgctgtcgccgcatatcgcgctgttggaa
gccggtttgccctacgatctggtcaaggtcgacattcgcgccaagaagctggagagcggc
gaggatttcctctcgatcaacccgaagggccaggtgccggcgctgatgctggacagcggc
gaggtggtgaccgagggcccggtgatcgtgcaggtgatcgccgacctcgccgcggcgaag
catctggcgcctgccgcgggttctccggagcgctacaagctgttggaatggttgaacttc
atcaccgctgagctgcacaaagggttcagcccgctgttccagccttcgatccccgacgag
gtcaaggcgttcttcaaggagcggctgatgggcaagttcaaatatctcgacggcgcactc
gccggtcacgattacctgatgggcgaccagttcaccgtcgccgacggctatctgttcacg
gtgctgcgctgggccgaagcgatgaagctggacctctccgcgctgaccacgctgaccgcc
tacaaggcccgcgtcgcggcgcggccgatggtgcagcaggcgctgagcaaggaaggcctg
atgaaggcggcgtaa

DBGET integrated database retrieval system