KEGG   Rhodopseudomonas palustris BisB18: RPC_0735Help
Entry
RPC_0735          CDS       T00336                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase, NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00071  Fatty acid degradation
rpc00280  Valine, leucine and isoleucine degradation
rpc00281  Geraniol degradation
rpc00310  Lysine degradation
rpc00362  Benzoate degradation
rpc00380  Tryptophan metabolism
rpc00410  beta-Alanine metabolism
rpc00640  Propanoate metabolism
rpc00650  Butanoate metabolism
rpc00903  Limonene and pinene degradation
rpc00930  Caprolactam degradation
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
rpc01120  Microbial metabolism in diverse environments
rpc01130  Biosynthesis of antibiotics
rpc01200  Carbon metabolism
rpc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RPC_0735
   00650 Butanoate metabolism
    RPC_0735
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RPC_0735
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPC_0735
   00310 Lysine degradation
    RPC_0735
   00380 Tryptophan metabolism
    RPC_0735
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPC_0735
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPC_0735
   00281 Geraniol degradation
    RPC_0735
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPC_0735
   00930 Caprolactam degradation
    RPC_0735
Enzymes [BR:rpc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RPC_0735
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RPC_0735
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RPC_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 UDPG_MGDP_dh_N DAO FAD_binding_3 F420_oxidored GIDA NAD_binding_8 ApbA Pyr_redox_2 LSDAT_euk Sacchrp_dh_NADP 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABD86306
UniProt: Q21BD0
LinkDB All DBs
Position
complement(804661..806877)
Genome map
AA seq 738 aa AA seqDB search
MAFKNFTIETDADGIALLTWDSPGRSMNVLDVTSIEELGAIVDQTTADAAVKGVVITSGK
EAFCAGADLAMLEALNKQFAEARKSKGEDAAQNMLFDESRKLSQILRKLETSGKPWVAAI
NGLALGGGFEVTLACHHRIAADNPKTKLGLPEIKVGLFPGGGGTQRLPRILQPADAMQML
LKGEQVNLAKAKASKIVDAIVPAADLIQAAKDWIKGGGKAIAPWDEKGFKLPGGPVFSKQ
GMMIFPAGNAIYRRETYDNYPAARAIMSCAYEGLLLPIDAALRVESRYFAHILQTKEAAA
MIRSLFISMQELNKGARRPQNVPPTKVKKLAIIGAGFMGASVGYVSAKGGIEVVLIDRDQ
DSADKGKAHCKSVIDGLIAKGRAKEADRDAILGRITATPDYNAIKDCDLVIEAVFEDRKV
KAETYAKAQPLLKEGAIFASNTSTLPITSLAEEFQDQSRFIGIHFFSPVEKMMLVEIIVG
KNTGDVALATALDYVRQISKTPIVVNDSRGFFANRCVLRFTAEGLEMLMEGIPPAMIENV
AKMAGMPVGPLSLADEVALDLVLKIMKATEADLGEQAVDQQQKKLMIELVEKQGRFGRKN
AKGFYDYPEKGKGQKSLWAGIAALQPKHLDPDTIDIEELKQRFLVVQAVEAARTVEDHVI
TDPREADVGSILGFGFAPFTGGTLSYIDFMGTKEFVALCHKLEAKYGSRFTPPKLLEDMA
KTGETFYGRFPPKKLAAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggccttcaagaatttcacgatcgagaccgacgccgacggcatcgcgctgctgacctgg
gacagtcccggccgttcgatgaacgtgctggacgtcaccagcatcgaagagctcggcgcc
atcgtcgaccagaccaccgccgacgccgcggtcaagggcgtggtgatcacctccggcaag
gaggcgttctgcgccggcgccgatctggcgatgttggaagctctgaacaagcagtttgcc
gaggcccgcaagtccaaaggcgaagacgccgcgcaaaacatgttgttcgacgagagccgt
aagctgtcgcagatcctgcgcaagctggagacttccggcaagccgtgggtcgcggcgatc
aacggcctcgcgctcggcggcggcttcgaagtgacgctggcctgccatcaccgcatcgcc
gccgacaatccgaagaccaaactcggcctgccggagatcaaggtcgggctgttcccgggc
ggcggcggcacccagcggctgccgcgcattctgcagccggccgacgccatgcagatgctg
ctgaagggcgagcaggtcaatctcgccaaagcgaaagcttcgaagatcgtcgacgccatc
gtgccggcggcggatttgatccaggccgccaaggattggatcaagggcggcggcaaggcc
atcgcaccctgggacgagaagggcttcaagctgcccggcggcccggtgttctccaagcag
ggcatgatgatcttcccggccggcaacgcgatctatcgccgcgaaacctacgacaactat
cccgccgcccgcgccatcatgagctgcgcctatgagggcctgttgctgccgatcgacgcc
gcgttgcgcgtcgagtcgcgctacttcgcccacatcctgcagaccaaggaggccgcggcg
atgatccgcagcctgttcatctcgatgcaggaattgaacaagggcgcgcggcggccgcaa
aacgtgccgccgaccaaggtcaagaagctcgcgatcatcggcgccggcttcatgggcgcc
agcgtcggctacgtctccgccaagggcggcatcgaggtggtgctgatcgaccgcgatcag
gacagcgccgacaagggcaaggcgcattgcaagagcgtgatcgacgggctgatcgccaag
ggccgcgccaaggaagccgaccgcgacgcgattctgggccggatcaccgcgaccccggac
tacaatgcgatcaaggattgcgacctcgtcatcgaggcggtgttcgaggatcgcaaggtc
aaggccgagacctacgccaaggcgcagccgctgctcaaggaaggcgcgatcttcgcctcc
aacacctcgacgctgccgatcacctcgctggccgaagagttccaggaccagtcgcgcttc
atcggcatccatttcttctcgccggtcgagaagatgatgctggtggaaatcatcgtcggc
aagaacaccggtgacgtcgcactcgccaccgcgctcgactacgtccgccagatcagcaag
accccgatcgtggtcaatgacagtcgcggcttcttcgccaaccgctgcgtgctgcgcttc
accgccgagggcctggaaatgctgatggaaggcattccgccggcgatgatcgagaacgtc
gccaagatggccggcatgccggtcggcccgctgtcgctcgccgacgaagtggcgctcgat
ctggtgctgaagatcatgaaggccaccgaggccgatctcggcgaacaggcggtcgatcag
cagcagaagaagctgatgatcgaactggtcgagaagcagggccggttcggccgcaagaac
gccaaggggttttatgactatccggagaagggcaagggccagaagagcctgtgggccggc
atcgccgcgctgcagccgaagcatctcgatccggatacgatcgacatcgaggaattgaag
cagcgctttttggtggtgcaggcggtcgaagccgcgcgcaccgtcgaggatcacgtcatc
accgatccgcgcgaggccgacgtcggctcgatcctcggcttcggcttcgccccgttcacc
ggcggcacgctgagctatatcgacttcatgggcaccaaagagttcgtggcgctgtgccac
aagctggaggccaaatacggctcgcgcttcaccccgccgaaacttctggaagacatggcg
aagaccggcgagaccttctacggccgcttcccaccgaagaagctggcggcggcgtaa

DBGET integrated database retrieval system