KEGG   Rhodopseudomonas palustris BisB18: RPC_1036
Entry
RPC_1036          CDS       T00336                                 

Definition
(GenBank) cyclohex-1-ene 1-carbonyl-CoA hydratase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00362  Benzoate degradation
rpc01100  Metabolic pathways
rpc01120  Microbial metabolism in diverse environments
rpc01220  Degradation of aromatic compounds
Module
rpc_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPC_1036
Enzymes [BR:rpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     RPC_1036
SSDB
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Other DBs
NCBI-ProteinID: ABD86601
UniProt: Q21AI5
LinkDB
Position
1136785..1137561
AA seq 258 aa
MAENVIIVEREGRVGLVTLNRPEMLNALNDELMDALGTALRDFDADDDIGAIVIAGSARA
FAAGADIAVMAEWSYSDVYKSNFVTRNWETIRQVRKPVLASVAGLAYGGGCELALACDII
VAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSGRPLEADEADCYGLVSRV
VDDDKLREETLKLAMTIASFSAPALMVLKETLNRAFETPLSEGILFERREMHARFAAPDA
REGITAFLEKRKPNFTHR
NT seq 777 nt   +upstreamnt  +downstreamnt
gtggcagagaacgtgatcatcgtcgaacgagaaggccgagtcggactcgtcacgctcaac
cgcccggagatgctcaacgcgctcaacgacgagttgatggatgcgctcggcacggcactg
cgcgatttcgacgccgacgatgacatcggcgccatcgtgatcgccggcagcgcgcgggcc
ttcgccgcgggcgccgatatcgccgtcatggccgagtggagctacagcgacgtctacaag
tcgaacttcgtcacccggaactgggagaccatccggcaggtgcgcaaaccggtgctggcc
tcggtcgcgggtctggcctatggcggcggatgcgaattggcgctggcctgcgacatcatc
gtcgccgcgcgcagcgccaaattcgcgctgccggagatcaagcttggcctattgcccggc
gccggcggcacccagcggctgccgcgcgccatcggcaaggccaaggcgatggacatgtgc
ctgtccggccgtccgctcgaggccgacgaggccgactgctacgggctggtgtcgcgcgtg
gtcgatgacgacaagctccgcgaagagaccttgaagcttgcgatgaccatcgcgtcgttc
tccgcccccgcattgatggtgctgaaggaaaccctcaatcgcgcgttcgagacgccgctg
agcgagggcatattgtttgaacggcgggaaatgcatgcccggttcgcggcgccggatgcc
cgcgaaggcatcacggcatttctggagaagcggaagccgaacttcacccatcgctga

DBGET integrated database retrieval system