KEGG   Rhodopseudomonas palustris BisB18: RPC_1328Help
Entry
RPC_1328          CDS       T00336                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00630  Glyoxylate and dicarboxylate metabolism
rpc00710  Carbon fixation in photosynthetic organisms
rpc01100  Metabolic pathways
rpc01120  Microbial metabolism in diverse environments
rpc01200  Carbon metabolism
Module
rpc_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rpc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rpc_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RPC_1328
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RPC_1328
Enzymes [BR:rpc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RPC_1328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABD86890
UniProt: Q219P6
LinkDB All DBs
Position
1445069..1445494
Genome map
AA seq 141 aa AA seqDB search
MRVTQGCFSFLPDLTDEQITSQVQYALGKGWAVNIEFTDDPHPRNTYWEMWGLPMFDLQD
AAGVLMELNECRKIYGDRYIRLSAFDSSPGWESVRLSFIVNRPKEEPGFRLERQESDGRN
TRYTTKSYAVDRPEGRRYGGS
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtgacccaaggctgtttctctttcctgcccgatctcaccgacgagcagatcacc
tcccaggtgcaatacgcgctcggcaaaggctgggcggtgaacatcgagttcaccgacgat
ccgcacccccgcaacacctattgggaaatgtggggcttgccgatgttcgatctgcaggac
gccgccggcgtgctgatggaattgaacgagtgccgcaagatctacggcgaccgttacatc
cggctgtcggcgttcgactccagccccggctgggaatcggtgcggctgtcgttcatcgtc
aacaggccgaaggaagagcccggcttccggctcgaacgtcaagagtccgacggccgcaat
acccgttacaccaccaaatcttatgcggtcgatcgtcccgagggtcggcgctacggtgga
tcatga

DBGET integrated database retrieval system