KEGG   Rhodopseudomonas palustris BisB18: RPC_1361Help
Entry
RPC_1361          CDS       T00336                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00564  Glycerophospholipid metabolism
rpc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RPC_1361
Enzymes [BR:rpc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RPC_1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox Pyr_redox_2 FAD_binding_2 FAD_oxidored FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABD86923
UniProt: Q219L3
LinkDB All DBs
Position
1485259..1486809
Genome map
AA seq 516 aa AA seqDB search
MGQVFDLAIIGGGINGCGIARDAAGRGNSVFLCEMNDLASGTSSWSTKLIHGGLRYLEYF
EFRLVREALIEREVLWQIAPHIIRPLRFVLPHHAGLRPAWRLRLGLLLYDYIGGRKLLPP
TSSLDLSREKVGEPLIPGRFKRGFEYSDCFVDDARLVLLTARDAADRGAEIRTRSRAVSI
RQADGLWQVTVEDTLSGARRSISARALVNAAGPWVESVLAEGSGVAPNSKVRLVQGSHIV
VPKLYDHDRAYIFQNADGRIVFAIPYQDDFTLIGTTDRDYEGDPAKVKASAEEIGYLCDS
VGAYLKKPVSPSDVMWTFSGVRPLYDDGASDAKAATREYVFELDVPKGGAPLLTIFGGKI
TTYRRLAEEALEKLAPYLHGDKAREGWTAKAPLPGGDFDVFGLGQLIGELRRSYPFLSEA
HAARLAGAYGTRAPLLLGTATSMADLGQSFGATLTEREVRYLMANEWAVTAEDVVWRRSK
LGLRLSVAEIAAIDGWMIAQRAAPTDGALRKAGGLP
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcaggttttcgacctcgcgatcattggcggcggcatcaacggctgcggcatcgcg
cgcgatgcggccggacgcggcaactcggtgtttctgtgcgagatgaacgatctggccagc
ggcacctcgtcgtggtcgaccaagctgatccacggcgggctgcgctatctggagtatttt
gaattccgcctggtgcgcgaggcgctgatcgagcgcgaggtgctgtggcagatcgcgccg
cacatcatccgcccgctgcgcttcgtgttgccgcatcacgccggcttgcgcccggcgtgg
cggctgcggctcgggctgttgctgtacgactatatcggcggccgcaagctgttgccgccg
acctcttcgctcgatctgtcgcgcgaaaaggtcggtgagccgctgatccccggccgcttc
aagcgcggttttgaatattccgactgcttcgtcgatgatgcccggctggtgctgctgacc
gcgcgcgatgccgccgatcgcggcgccgagatccgcacccgcagccgcgcggtgtcgatc
cgccaggccgacggcctctggcaggtcacggtggaggacacgctgagcggtgcgcgccgc
agcatcagcgcgcgcgcgctggtcaacgccgccggcccctgggtcgagagcgtgctggcc
gagggctccggcgtcgcgcccaacagcaaggtgcggctggtgcagggctcgcacatcgtg
gtgccgaaactgtacgaccacgaccgcgcctacatcttccagaacgccgacggccgcatc
gtgttcgcgatcccctatcaggacgacttcacgctgatcggcaccaccgaccgcgactac
gagggcgatcccgccaaggtgaaagcctcggccgaggagatcggctatctgtgcgactcc
gtcggcgcctatctgaaaaagccggtgagcccgtcggacgtgatgtggacgttctccggg
gtgcggccgctctatgacgacggcgccagcgacgccaaggccgcgacccgcgaatacgtc
ttcgagctcgacgtgccgaaaggcggcgcgccgctgttgacgatcttcggcggcaagatc
accacctatcgcaggctcgccgaagaggcattggagaagctggcgccgtatctgcacggc
gacaaggcgcgcgagggctggaccgccaaagcgccattgccgggcggcgatttcgacgtg
ttcggccttggccaactgatcggcgaactgcgccgcagctatccgtttctgtccgaggcg
cacgccgcacggctggccggcgcctacggcacccgcgcgccgctgttgctcggtaccgcg
acctcgatggccgatctcggccaatcgttcggcgctacgctgaccgagcgcgaggtgcgc
tatctgatggccaacgaatgggcggtgaccgccgaggacgtcgtctggcgccgctccaag
ctcggcctgcggctgtcggtggccgagatcgccgcgatcgacggctggatgatcgcgcag
cgcgcggcgccgaccgatggcgcgttgcgtaaggcgggagggctgccgtga

DBGET integrated database retrieval system