KEGG   Rhodopseudomonas palustris BisB18: RPC_1684Help
Entry
RPC_1684          CDS       T00336                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00620  Pyruvate metabolism
rpc00680  Methane metabolism
rpc00710  Carbon fixation in photosynthetic organisms
rpc01100  Metabolic pathways
rpc01120  Microbial metabolism in diverse environments
rpc01200  Carbon metabolism
Module
rpc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPC_1684
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RPC_1684
   00680 Methane metabolism
    RPC_1684
Enzymes [BR:rpc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RPC_1684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABD87243
UniProt: Q218E3
LinkDB All DBs
Position
1820630..1823419
Genome map
AA seq 929 aa AA seqDB search
MSSKIMPIDPIAQKTPVAEDPAAIDEDARLRDDIRLLGRILGDTVRDQEGEGVFDVVERI
RQTSIRFHRDNDKPARSELEAILDGLSTPDTVRIVRAFSYFSHLANIAEDQNNIRQMRAL
SGTPRPGSVVGTLAHARAVGISAQELRRFFAHALVSPVLTAHPTEVRRKSTMDREMEVAG
LLDRRERLQMTAEEVAQHEEQLRRAVLTLWQTNMLRRTKLTVLDEVKNGLSFYDHSFLRE
VPRLHGLLEDRLNDDDGRDEELASFLRMGSWIGGDRDGNPFVTAEVMRGALRLQSTRALR
FYLDELHALGSELSIAAHLADVSDDLRLLAERSPDTSPHRSGEPYRLAVSGIYARLAATA
HKLKFDDIRAPVGAAEPYADPQEFKADLDVLHRSLIANQASVIARGRLRQLRRAVDCFGF
HLASLDMRQNSAVHERTMTELIDAAMPGKSYMAMNEEARIALLAGELRSTRPLASPFVKY
GEETLGELAVFRTAAEAHAAFGHTVISQCIISMCKGVSDMLEVVLLLKEVGLVDHAGRSA
INVVPLFETIEDLQASAGIMDRLLSLHDYRRLVDSRGGVQEVMLGYSDSNKDGGFVTSGW
ELYKAEIELVKVFEHHGVRLRLFHGRGGSVGRGGGPSYDAILAQPGGAVNGQIRITEQGE
IITSKYSNAEVGRNNLEILAAATLEASLLMPRQSAPRAEYLDAMEQLSSFAFKAYRGLVY
ETEGFEDYFWASTVITEIATLNIGSRPASRKKTHKIEDLRAIPWVFSWAQCRLMLPGWYG
FGSAVEAFVKEHPDKGMAFLQELYREWPFFRTLLSNMDMVLAKSSIAIASRYAELVPDEQ
LRQAIFGRIRAEWHGSIQALLDIMQQDRLLQSNPRLERSIRNRFPYLDPLNHVQVELLKE
HRSHAIDEKVLRGIQLTINGISAGLRNSG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccaagatcatgcccatcgacccgatcgcgcaaaagactcccgtcgccgaggac
cccgccgcgatcgacgaggatgccaggctgcgcgacgacatccggctgctggggcggatt
ctcggcgacaccgtccgtgaccaggagggggagggcgtgttcgacgtggtcgaacgcatc
cggcagacctcgatccgctttcaccgtgacaacgacaagccggcgcgcagcgagctcgaa
gccattctcgacgggttgtcgacccccgacacggtgcgcatcgtccgcgccttcagctat
ttctcgcatctcgccaacatcgccgaggaccagaacaacatccggcagatgcgggcgctg
agcggcaccccgcggccgggttcggtggtcggcacgctggcgcatgcccgcgcggtcggg
atcagcgcgcaagagctgcgccgcttcttcgcccacgcgctggtcagcccggtgttgacg
gcgcaccccaccgaggtccgccgcaagagcacgatggaccgcgagatggaggtcgcaggc
ctgctcgaccgccgcgagcggttgcagatgacggcggaggaagtcgcgcagcacgaggag
cagctgcgccgcgccgtgctgacgctgtggcagaccaacatgctgcgccggaccaagctc
accgtgctcgacgaggtcaagaacgggctgtcgttctacgaccacagcttcctgcgcgaa
gtgccgcggctgcacggcttgctggaagatcgtctcaacgacgacgacggccgcgacgag
gagctcgcctcgttcctgcggatgggcagctggatcggtggcgaccgcgacggcaacccg
ttcgtcaccgccgaggtgatgcgcggcgcgctgcggctgcagagcacccgggcgctgcgc
ttctatctcgacgaactgcatgcgctgggctccgaactgtcgatcgccgcgcatctggcc
gacgtctccgacgacctgcggctgttggccgaacgctcgcccgacacctcgccgcatcgc
agcggcgagccgtatcggctggcagtgtcggggatctatgcgcggctcgccgccaccgcg
cacaaattgaaattcgacgatatccgcgctccggtcggcgccgccgagccctacgccgat
ccgcaggagttcaaggccgacctcgacgtgctgcatcgctcgctgatcgccaaccaggcc
tcggtgatcgcgcgcggccggctgcgccagctgcgccgcgcggtggattgcttcggcttc
catctcgccagcctcgacatgcggcagaactccgcggtgcatgagcgcaccatgaccgag
ctgatcgacgccgcgatgccgggcaagtcctacatggcgatgaacgaggaggcgcggatc
gcgctgctcgctggcgaactgcgctcgacgcggccgttggcgtcgccgttcgtgaaatat
ggcgaggagacgctcggcgaactcgccgtgttccgcaccgccgccgaggcccacgccgct
tttggtcacaccgtgatttcccaatgcatcatctcgatgtgcaagggcgtctccgacatg
ctcgaggtggtgctgctattgaaggaggtcggcctggtcgatcacgccgggcgcagcgcc
atcaacgtggtgccgctgttcgagaccatcgaggatctgcaagcctccgccgggatcatg
gaccggctgttgtcgctgcacgattatcgccggctggtggatagccgcggcggcgtccag
gaagtgatgctgggctattccgacagcaacaaggatggcggcttcgtcacctcgggctgg
gagctgtacaaggccgagatcgaactggtgaaggtgttcgagcatcacggcgtgcggctg
cggctgtttcacggccgcggcggctcggtcggccgtggcggtgggccgagctacgacgcc
atcctggcgcagcccggcggcgcggtgaacggtcagatccgcatcaccgaacagggcgag
atcatcaccagcaaatattccaacgccgaggtcggccgcaacaatctggagattcttgcc
gctgcaacgctggaggccagcctgctgatgccgcggcagagcgcgccgcgtgccgaatat
ctcgacgccatggagcaattgtcgtcattcgccttcaaggcctatcgcggcctggtctac
gagaccgaaggcttcgaggattacttctgggcttccacggtaatcaccgaaatcgccacg
ctgaacatcggcagccgcccggcgtcgcgcaagaagacccacaagatcgaggatctgcgc
gcgatcccctgggtgttctcgtgggcgcaatgccggctgatgctgcccggctggtacggt
tttggcagcgcggttgaggccttcgtcaaagagcatcccgacaagggcatggcgttcctg
caggaactgtatcgcgagtggccgttcttccgcaccttgctgtcgaacatggacatggtg
ctggcgaagagttcgatcgcgatcgcctcgcgctatgccgaattggtgcctgacgaacag
ctgcggcaggcaatcttcggccggatccgcgccgagtggcacggctcgatccaggcgctg
ctcgacatcatgcagcaggaccggctgctgcagagcaacccgcgtctcgagcgttcgatc
cgcaaccgctttccctatctcgatccgctcaatcacgtgcaggtcgagctgttgaaagag
caccgcagccacgccatcgacgagaaggtgctgcgcggcatccagctcaccatcaacggc
atctccgccgggttgcgcaacagcggctag

DBGET integrated database retrieval system